Property Summary

NCBI Gene PubMed Count 38
PubMed Score 31.76
PubTator Score 23.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -5.100 8.0e-10
astrocytoma -1.700 2.1e-10
posterior fossa group A ependymoma -4.900 6.8e-15
glioblastoma -4.300 6.1e-05
oligodendroglioma -1.600 2.0e-08
medulloblastoma -2.500 2.1e-03
atypical teratoid / rhabdoid tumor -4.100 9.2e-05
medulloblastoma, large-cell -3.900 6.8e-05
primitive neuroectodermal tumor -3.000 3.0e-04
adrenocortical carcinoma -1.211 9.9e-05
pediatric high grade glioma -3.000 6.2e-04
pilocytic astrocytoma -1.800 5.3e-04
Endometriosis -1.634 1.6e-02
lung carcinoma 2.100 1.1e-12
ovarian cancer -1.300 3.9e-02

Gene RIF (14)

PMID Text
26485182 This study revealed a significant variant (rs12455524) within the gene DLGAP1 for Recurrent major depression.
25950743 These results strongly suggested involvement of the DLGAP1 gene product in the development of HIV-related lipoatrophy in Thai HIV patients.
24938595 Dimerization of DLC2 was required for its interaction with GKAP, which, in turn, potentiated GKAP self-association.
24821223 This study showed that DLGAP1 association with obsessive-compulsive disorder.
24156266 Results show that the expression and distribution of NMDA receptors subunits GluN1, GluN2A and GluN2B - together with that of postsynaptic protein PSD-95 - are modified in Alzheimer's disease compared to normal aging
22940546 Study identified six genetic variants, (rs145691437, rs3786431, rs201567254, rs3745051 and rs11662259) and one rare missense mutation (c.1922A>G). SNP- and haplotype-based analyses showed no association of these SNPs with schizophrenia.
22889921 dlgap1 showed the highest association, of snps examined, with ocd.
21070662 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
21041448 The GKAP controls the forces operating on microtubules and play a fundamental role in centrosome positioning and cell polarity.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of discs, large (Drosophila) homolog-associated protein 1 (DLGAP1; LOC284214) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MKGLSGSRSHHHGVTCDSACDSLSHHSDRKPYLLSPVEHHPADHPYYTQRNSFQAECVGPFSDPLASSTF      1 - 70
PRRHYTSQQELKDECALVPRTLATKANRIPANLLDQFERQLPLSRDGYHTLQYKRTAVEHRSDSPGRIRH     71 - 140
LVHSVQKLFTKSHSLEGPSKGSVNGGKASPDEAQAARYGKRSKSKERRAEPKARPSTSPGWWSSDDNLDG    141 - 210
DMCIYHAPSGVMTMGRCPDRSASQYFLEAYNTISEQAVKASRSNNDVKCSTCANLPVSLDTPLLKKSAWS    211 - 280
STLTVSRAREVYQKASVNMDQAMVKSESCQQERSCQYLQVPQDEWTGYTPRGKDDEIPCRRMRSGSYIKA    281 - 350
MGDEDSGDSDTSPKPSPKVAARRESYLKATQPSLTELTTLKISNEHSPKLQIRSHSYLRAVSEVSINRSL    351 - 420
DSLDPAGLLTSPKFRSRNESYMRAMSTISQVSEMEVNGQFESVCESVFSELESQAVEALDLPMPGCFRMR    421 - 490
SHSYVRAIEKGCSQDDECVSLRSSSPPRTTTTVRTIQSSTVSSCITTYKKTPPPVPPRTTTKPFISITAQ    491 - 560
SSTESAQDAYMDGQGQRGDIISQSGLSNSTESLDSMKALTAAIEAANAQIHGPASQHMGNNTATVTTTTT    561 - 630
IATVTTEDRKKDHFKKNRCLSIGIQVDDAEEPDKTGENKAPSKFQSVGVQVEEEKCFRRFTRSNSVTTAV    631 - 700
QADLDFHDNLENSLESIEDNSCPGPMARQFSRDASTSTVSIQGSGNHYHACAADDDFDTDFDPSILPPPD    701 - 770
PWIDSITEDPLEAVQRSVCHRDGHWFLKLLQAERDRMEGWCQQMEREERENNLPEDILGKIRTAVGSAQL    771 - 840
LMAQKFYQFRELCEENLNPNAHPRPTSQDLAGFWDMLQLSIENISMKFDELHQLKANNWKQMDPLDKKER    841 - 910
RAPPPVPKKPAKGPAPLIRERSLESSQRQEARKRLMAAKRAASVRQNSATESAESIEIYIPEAQTRL       911 - 977
//

Text Mined References (40)

PMID Year Title
26485182 2016 Recurrent major depression and right hippocampal volume: A bivariate linkage and association study.
25950743 2015 Genome-Wide Association Study of HIV-Related Lipoatrophy in Thai Patients: Association of a DLGAP1 Polymorphism with Fat Loss.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24938595 2014 The stoichiometry of scaffold complexes in living neurons - DLC2 functions as a dimerization engine for GKAP.
24821223 2015 Genome-wide association study in obsessive-compulsive disorder: results from the OCGAS.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24156266 2014 Pathological reorganization of NMDA receptors subunits and postsynaptic protein PSD-95 distribution in Alzheimer's disease.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23247143 2013 Association of genome-wide variation with highly sensitive cardiac troponin-T levels in European Americans and Blacks: a meta-analysis from atherosclerosis risk in communities and cardiovascular health studies.
22940546 2013 Genetic analysis of the DLGAP1 gene as a candidate gene for schizophrenia.
22911880 2012 Genome-wide association analysis of eating disorder-related symptoms, behaviors, and personality traits.
22889921 2013 Genome-wide association study of obsessive-compulsive disorder.
22566634 2012 The genetic architecture of economic and political preferences.
22117215 2011 Guanylate kinase domains of the MAGUK family scaffold proteins as specific phospho-protein-binding modules.
21070662 2010 Schizophrenia and vitamin D related genes could have been subject to latitude-driven adaptation.
21041448 2010 Dlg1 binds GKAP to control dynein association with microtubules, centrosome positioning, and cell polarity.
20936779 2010 A human MAP kinase interactome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15673434 2005 A novel scaffold protein, TANC, possibly a rat homolog of Drosophila rolling pebbles (rols), forms a multiprotein complex with various postsynaptic density proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12954649 2003 Crystal structure of the Shank PDZ-ligand complex reveals a class I PDZ interaction and a novel PDZ-PDZ dimerization.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11122378 2000 The hDLG-associated protein DAP interacts with dynein light chain and neuronal nitric oxide synthase.
11060025 2000 Intramolecular interactions regulate SAP97 binding to GKAP.
10844022 2000 Interaction of the postsynaptic density-95/guanylate kinase domain-associated protein complex with a light chain of myosin-V and dynein.
10527873 1999 Proline-rich synapse-associated proteins ProSAP1 and ProSAP2 interact with synaptic proteins of the SAPAP/GKAP family.
10521485 1999 nArgBP2, a novel neural member of ponsin/ArgBP2/vinexin family that interacts with synapse-associated protein 90/postsynaptic density-95-associated protein (SAPAP).
9756850 1998 BEGAIN (brain-enriched guanylate kinase-associated protein), a novel neuronal PSD-95/SAP90-binding protein.
9694864 1998 A novel multiple PDZ domain-containing molecule interacting with N-methyl-D-aspartate receptors and neuronal cell adhesion proteins.
9286858 1997 DAP-1, a novel protein that interacts with the guanylate kinase-like domains of hDLG and PSD-95.
9221768 1997 Characterization of guanylate kinase-associated protein, a postsynaptic density protein at excitatory synapses that interacts directly with postsynaptic density-95/synapse-associated protein 90.
9115257 1997 SAPAPs. A family of PSD-95/SAP90-associated proteins localized at postsynaptic density.
9024696 1997 GKAP, a novel synaptic protein that interacts with the guanylate kinase-like domain of the PSD-95/SAP90 family of channel clustering molecules.