Property Summary

NCBI Gene PubMed Count 65
PubMed Score 56.50
PubTator Score 70.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytoma 1.700 1.3e-02
oligodendroglioma 1.800 1.2e-02
cutaneous lupus erythematosus -1.200 6.6e-03
osteosarcoma 1.661 1.1e-06
Amyotrophic Lateral Sclerosis 1.099 5.2e-09
acute quadriplegic myopathy 1.130 2.5e-07
tuberculosis -1.200 1.3e-04
pancreatic ductal adenocarcinoma liver m... 2.197 3.3e-02
non-small cell lung cancer 1.502 8.1e-21
intraductal papillary-mucinous adenoma (... 1.200 3.8e-03
intraductal papillary-mucinous neoplasm ... 1.300 1.1e-02
lung cancer 1.400 3.4e-04
breast carcinoma 1.200 1.6e-02
interstitial cystitis -1.200 7.3e-04
group 3 medulloblastoma 1.300 8.1e-04
spina bifida -1.442 4.6e-02
ovarian cancer -1.900 3.0e-05
pituitary cancer -1.400 3.8e-05
dermatomyositis 1.600 4.0e-04

Pathway (1)

Gene RIF (63)

PMID Text
25478998 These data suggest that inhibition of Dlg5 by DNA hypermethylation contributes to provoke invasive phenotypes in bladder tumor.
24910533 DLG5 plays a role in cell migration, cell adhesion, precursor cell division, cell proliferation, epithelial cell polarity maintenance, and transmission of extracellular signals to the membrane and cytoskeleton.
24662825 Findings demonstrate that Dlg5 interacts with and inhibits the activity of Girdin, thereby suppressing the migration of prostate cancer cells.
23624079 Overexpression of Dlg5 enhances the degradation of TGFBRI.
22118696 Polymorphisms in the DLG5 gene were found to be associated with Crohn's disease patients in Malaysia.
22065243 Examined the genetic association of DLG5 SNP P1371Q with inflammatory bowel disease and its interaction with R30Q in disease susceptibility. P1371Q is complementary to R30Q, with R30Q exhibiting a dominant effect in IBD susceptibility.
21674725 Increased expression of discs large homolog 5 gene is associated with ulcerative colitis.
20886065 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20796250 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20037206 In the studied population, DLG5 R30Q was associated with all forms of IBD. An elevated presence of the R30Q variant was observed in all members of a familial IBD registry
20037206 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
19422935 Observational study of gene-disease association. (HuGE Navigator)
18824555 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18804983 Observational study of gene-disease association. (HuGE Navigator)
18715515 Observational study of gene-disease association. (HuGE Navigator)
18559397 findings show that the inflammatory bowel disease-susceptibility gene DLG5 is also associated with gluten-sensitive enteropathy
18466472 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18433468 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18397186 Observational study of gene-disease association. (HuGE Navigator)
18338763 Observational study of gene-disease association. (HuGE Navigator)
18335190 Results provide evidence that the scaffolding protein DLG5 belongs to the CARD protein family.
17693570 Observational study of gene-disease association. (HuGE Navigator)
17693570 DLG5 30Q is associated with a small reduction in risk of Crohn disease in women in a Caucasian cohort.
17544013 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17476680 Observational study of gene-disease association. (HuGE Navigator)
17476680 polymorphisms 3020insC in CARD15 and SNP rs2165047 in DLG5 may have a role in pediatric-onset Crohn's disease
17455201 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17455201 the DLG5 haplotype A is associated with reduced risk of inflammatory bowel disease in the New Zealand Caucasian population
17451203 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17451203 polymorphism exerts a weak influence on Crohn's disease phenotype
17307543 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17307543 DLG5 gene missense mutation is associated with increased susceptibility to inflammatory bowel diseases in children.
17156146 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17156146 DLG5 has a gender-specific role in the susceptibility of pediatric CD. Significant negative association found between DLG5 R30Q and CD in female children suggests DLG5 may have a protective effect in CD susceptibility for female children.
17100974 Observational study of gene-disease association. (HuGE Navigator)
16944184 The R30Q variant in the DLG5 gene does not appear to be associated with an overall increase in the risk of disease in a British IBD cohort
16773680 The initial report of DLG5 as a novel inflammatory bowel disease (IBD) susceptibility gene sparked a multitude of studies concerning its role in the aetiology of Crohn disease and IBD.
16670524 Observational study of gene-disease association. (HuGE Navigator)
16670523 Observational study of gene-disease association. (HuGE Navigator)
16534418 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16494592 Observational study of gene-disease association. (HuGE Navigator)
16493449 Observational study of gene-disease association. (HuGE Navigator)
16450402 Observational study of gene-disease association. (HuGE Navigator)
16450402 The results indicate a role for DLG5 variants in inflammatory bowel disease (IBD) susceptibility.
16446977 Observational study of gene-disease association. (HuGE Navigator)
16446977 R30Q variant constitutes a susceptibility factor for Crohn disease (CD) in men.
16437728 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16437728 The G113A polymorphism of the DLG5 gene was completely absent in Greek Crohn disease cases as well as the Greek healthy population
16391570 there are significant population allele frequency differences at the DLG5 gene [letter]
16385451 Observational study of gene-disease association. (HuGE Navigator)
16344053 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15955786 Observational study of gene-disease association. (HuGE Navigator)
15930978 Genetic variation in DLG5 is associated with inflammatory bowel disease
15843420 Observational study of gene-disease association. (HuGE Navigator)
15841097 Observational study of gene-disease association. (HuGE Navigator)
15841097 DLG5 constitutes a true inflammatory bowel diseases risk factor of modest effect
15665285 Collaboration of RAB6KIFL and DLG5 is likely to be involved in pancreatic cancer.
15107852 Genetic variation in DLG5 is associated with inflammatory bowel disease
12657639 findings suggest that lp-dlg/KIAA0583 is a novel scaffolding protein that can link the vinexin-vinculin complex and beta-catenin at sites of cell-cell contact

AA Sequence

MEPQRRELLAQCQQSLAQAMTEVEAVLGLLEAAGALSPGERRQLDEEAGGAKAELLLKLLLAKERDHFQD      1 - 70
LRAALEKTQPHLLPILYLNGVVGPPQPAEGAGSTYSVLSTMPSDSESSSSLSSVGTTGKAPSPPPLLTDQ     71 - 140
QVNEKVENLSIQLRLMTRERNELRKRLAFATHGTAFDKRPYHRLNPDYERLKIQCVRAMSDLQSLQNQHT    141 - 210
NALKRCEEVAKETDFYHTLHSRLLSDQTRLKDDVDMLRRENGQLLRERNLLQQSWEDMKRLHEEDQKEIG    211 - 280
DLRAQQQQVLKHNGSSEILNKLYDTAMDKLEVVKKDYDALRKRYSEKVAIHNADLSRLEQLGEENQRLLK    281 - 350
QTEMLTQQRDTAIQLQHQCALSLRRFEAIHHELNKATAQNKDLQWEMELLQSELTELRTTQVKTAKESEK    351 - 420
YREERDAVYSEYKLIMSERDQVISELDKLQTEVELAESKLKSSTSEKKAANEEMEALRQIKDTVTMDAGR    421 - 490
ANKEVEILRKQCKALCQELKEALQEADVAKCRRDWAFQERDKIVAERDSIRTLCDNLRRERDRAVSELAE    491 - 560
ALRSLDDTRKQKNDVSRELKELKEQMESQLEKEARFRQLMAHSSHDSAIDTDSMEWETEVVEFERETEDI    561 - 630
DLKALGFDMAEGVNEPCFPGDCGIFVTKVDKGSIADGRLRVNDWLLRINDVDLINKDKKQAIKALLNGEG    631 - 700
AINMVVRRRKSLGGKVVTPLHINLSGQKDSGISLENGVYAAAVLPGSPAAKEGSLAVGDRIVAINGIALD    701 - 770
NKSLNECESLLRSCQDSLTLSLLKVFPQSSSWSGQNIFENIKDSDKMLSFRAHGPEVQAHNKRNLIQHNN    771 - 840
STQTDIFYTDRLEDRKEPGPPGGSSSFLHKPFPGGPLQVCPQACPSASERSLSSFRSDASGDRGFGLVDV    841 - 910
RGRRPLLPFETEVGPCGVGEASLDKADSEGSNSGGTWPKAMLSSTAVPEKLSVYKKPKQRKSIFDPNTFK    911 - 980
RPQTPPKIDYLLPGPGPAHSPQPSKRAGPLTPPKPPRRSDSIKFQHRLETSSESEATLVGSSPSTSPPSA    981 - 1050
LPPDVDPGEPMHASPPRKARVRIASSYYPEGDGDSSHLPAKKSCDEDLTSQKVDELGQKRRRPKSAPSFR   1051 - 1120
PKLAPVVIPAQFLEEQKCVPASGELSPELQEWAPYSPGHSSRHSNPPLYPSRPSVGTVPRSLTPSTTVSS   1121 - 1190
ILRNPIYTVRSHRVGPCSSPPAARDAGPQGLHPSVQHQGRLSLDLSHRTCSDYSEMRATHGSNSLPSSAR   1191 - 1260
LGSSSNLQFKAERIKIPSTPRYPRSVVGSERGSVSHSECSTPPQSPLNIDTLSSCSQSQTSASTLPRIAV   1261 - 1330
NPASLGERRKDRPYVEEPRHVKVQKGSEPLGISIVSGEKGGIYVSKVTVGSIAHQAGLEYGDQLLEFNGI   1331 - 1400
NLRSATEQQARLIIGQQCDTITILAQYNPHVHQLSSHSRSSSHLDPAGTHSTLQGSGTTTPEHPSVIDPL   1401 - 1470
MEQDEGPSTPPAKQSSSRIAGDANKKTLEPRVVFIKKSQLELGVHLCGGNLHGVFVAEVEDDSPAKGPDG   1471 - 1540
LVPGDLILEYGSLDVRNKTVEEVYVEMLKPRDGVRLKVQYRPEEFTKAKGLPGDSFYIRALYDRLADVEQ   1541 - 1610
ELSFKKDDILYVDDTLPQGTFGSWMAWQLDENAQKIQRGQIPSKYVMDQEFSRRLSMSEVKDDNSATKTL   1611 - 1680
SAAARRSFFRRKHKHKRSGSKDGKDLLALDAFSSDSIPLFEDSVSLAYQRVQKVDCTALRPVLILGPLLD   1681 - 1750
VVKEMLVNEAPGKFCRCPLEVMKASQQAIERGVKDCLFVDYKRRSGHFDVTTVASIKEITEKNRHCLLDI   1751 - 1820
APHAIERLHHMHIYPIVIFIHYKSAKHIKEQRDPIYLRDKVTQRHSKEQFEAAQKLEQEYSRYFTGVIQG   1821 - 1890
GALSSICTQILAMVNQEQNKVLWIPACPL                                            1891 - 1919
//

Text Mined References (70)

PMID Year Title
25478998 2015 Methylation-mediated silencing of Dlg5 facilitates bladder cancer metastasis.
24910533 2014 DLG5 in cell polarity maintenance and cancer development.
24662825 2015 Loss of Dlg5 expression promotes the migration and invasion of prostate cancer cells via Girdin phosphorylation.
23624079 2013 Dlg5 interacts with the TGF-? receptor and promotes its degradation.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22118696 2011 Identification of DLG5 and SLC22A5 gene polymorphisms in Malaysian patients with Crohn's disease.
22065243 2011 DLG5 P1371Q is associated with inflammatory bowel disease and complementary to R30Q in disease susceptibility.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21674725 2011 Increased expression of discs large homolog 5 gene (DLG5) in ulcerative colitis patients compared to healthy individuals.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20886065 2010 Molecular reclassification of Crohn's disease by cluster analysis of genetic variants.
20796250 2011 The R30Q DLG5 variant is not associated with celiac disease or inflammatory bowel disease in the Spanish population.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20037206 2009 Genetic association of DLG5 R30Q with familial and sporadic inflammatory bowel disease in men.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19422935 2009 Genetic risk profiling and prediction of disease course in Crohn's disease patients.
18987736 2008 DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome.
18824555 2009 Molecular prediction of disease risk and severity in a large Dutch Crohn's disease cohort.
18804983 2009 Association of genetic profiles to Crohn's disease by linear combinations of single nucleotide polymorphisms.
18715515 2008 Lack of evidence for association of primary sclerosing cholangitis and primary biliary cirrhosis with risk alleles for Crohn's disease in Polish patients.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18559397 2008 Association of DLG5 variants with gluten-sensitive enteropathy.
18466472 2007 Constructing gene association networks for rheumatoid arthritis using the backward genotype-trait association (BGTA) algorithm.
18433468 2008 Inflammatory response gene polymorphisms and their relationship with colorectal cancer risk.
18397186 2008 Interaction between seroreactivity to microbial antigens and genetics in Crohn's disease: is there a role for defensins?
18338763 2008 Association of IL23R, TNFRSF1A, and HLA-DRB1*0103 allele variants with inflammatory bowel disease phenotypes in the Finnish population.
18335190 2008 The Crohn's disease susceptibility gene DLG5 as a member of the CARD interaction network.
17693570 2008 Gender-stratified analysis of DLG5 R30Q in 4707 patients with Crohn disease and 4973 controls from 12 Caucasian cohorts.
17544013 2007 Prospective study of interaction between alcohol, NSAID use and polymorphisms in genes involved in the inflammatory response in relation to risk of colorectal cancer.
17476680 2007 Genetic susceptibility has a more important role in pediatric-onset Crohn's disease than in adult-onset Crohn's disease.
17455201 2007 Association of DLG5 variants with inflammatory bowel disease in the New Zealand Caucasian population and meta-analysis of the DLG5 R30Q variant.
17451203 2007 Role of CARD15, DLG5 and OCTN genes polymorphisms in children with inflammatory bowel diseases.
17307543 2007 The contribution of the DLG5 113A variant in early-onset inflammatory bowel disease.
17156146 2007 DLG5 R30Q variant is a female-specific protective factor in pediatric onset Crohn's disease.
17100974 2007 Genetic polymorphisms associated with inflammatory bowel disease do not confer risk for primary sclerosing cholangitis.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16944184 2007 Investigation of association of the DLG5 gene with phenotypes of inflammatory bowel disease in the British population.
16773680 2006 Role of discs large homolog 5.
16670524 2006 DLG5 R30Q is not associated with IBD in Hungarian IBD patients but predicts clinical response to steroids in Crohn's disease.
16670523 2006 Relationship between CARD15, SLC22A4/5, and DLG5 polymorphisms and early-onset inflammatory bowel diseases: an Italian multicentric study.
16534418 2006 Genetic variants in TNF-alpha but not DLG5 are associated with inflammatory bowel disease in a large United Kingdom cohort.
16494592 2006 DLG5 variants in inflammatory bowel disease.
16493449 2006 Extreme heterogeneity in CARD15 and DLG5 Crohn disease-associated polymorphisms between German and Norwegian populations.
16450402 2006 DLG5 variants contribute to Crohn disease risk in a Canadian population.
16446977 2006 Evidence of transmission ratio distortion of DLG5 R30Q variant in general and implication of an association with Crohn disease in men.
16437728 2005 Single nucleotide polymorphisms of OCTN1, OCTN2, and DLG5 genes in Greek patients with Crohn's disease.
16391570 2006 Association of DLG5 and inflammatory bowel disease across populations.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344053 2005 Association of organic cation transporter risk haplotype with perianal penetrating Crohn's disease but not with susceptibility to IBD.
15955786 2005 Polymorphisms in the DLG5 and OCTN cation transporter genes in Crohn's disease.
15952887 2005 Membrane-associated guanylate kinases regulate adhesion and plasticity at cell junctions.
15930978 2005 Recent advances in the genetics of inflammatory bowel disease.
15843420 2005 DLG5 variants do not influence susceptibility to inflammatory bowel disease in the Scottish population.
15841097 2005 Association of DLG5 R30Q variant with inflammatory bowel disease.
15665285 2005 Down-regulation of RAB6KIFL/KIF20A, a kinesin involved with membrane trafficking of discs large homologue 5, can attenuate growth of pancreatic cancer cell.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15107852 2004 Genetic variation in DLG5 is associated with inflammatory bowel disease.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12657639 2003 Interaction of lp-dlg/KIAA0583, a membrane-associated guanylate kinase family protein, with vinexin and beta-catenin at sites of cell-cell contact.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12353226 2002 HDLG5/KIAA0583, encoding a MAGUK-family protein, is a primary progesterone target gene in breast cancer cells.
11876824 2002 The cloning, genomic organization and tissue expression profile of the human DLG5 gene.
10903836 2000 Construction of a high-resolution physical map of the chromosome 10q22-q23 dilated cardiomyopathy locus and analysis of candidate genes.
9738934 1998 Identification of a novel human homolog of the Drosophila dlg, P-dlg, specifically expressed in the gland tissues and interacting with p55.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.