Property Summary

NCBI Gene PubMed Count 55
PubMed Score 49.90
PubTator Score 35.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
interstitial lung disease 1.100 1.3e-02
astrocytic glioma -2.300 3.9e-03
ependymoma -4.100 1.7e-29
oligodendroglioma -2.300 9.9e-16
cutaneous lupus erythematosus -2.600 3.4e-04
psoriasis -2.600 1.3e-04
glioblastoma -4.400 1.4e-08
medulloblastoma -3.400 1.0e-06
atypical teratoid / rhabdoid tumor -4.600 4.0e-11
medulloblastoma, large-cell -4.800 1.9e-08
primitive neuroectodermal tumor -3.100 6.4e-05
adrenocortical carcinoma -1.908 5.1e-04
lung cancer 1.500 5.1e-03
interstitial cystitis -1.300 8.9e-04
pediatric high grade glioma -4.000 2.1e-10
pilocytic astrocytoma -3.300 8.9e-13
aldosterone-producing adenoma -1.132 4.6e-02
subependymal giant cell astrocytoma -2.503 1.6e-02
lung carcinoma 2.800 5.4e-33

Gene RIF (13)

PMID Text
26460480 DLG2 - novel candidate genes validated in a large case-control sample of schizophrenia.
23519667 The PDZ1 domain of PSD-93 might accept peptides with larger residues at the C-terminus than that of PSD-95, for example the GluD2 C-terminal Ile versus the Val found at the C-terminus of NMDA receptors.
23201973 This study showed that DLG2 is related the complex learning.
20398908 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20054121 Comparison of the structures of the binding cleft of PSD-93 PDZ1 with the previously reported structures of PSD-93 PDZ2 and PDZ3 as well as of the closely related human PSD-95 PDZ1 shows that they are very similar in terms of amino-acid composition
19931931 Variation at the DLG2 locus contributes to maintenance of glucose homeostasis through regulation of insulin sensitivity and beta-cell function.
19931931 Observational study of gene-disease association. (HuGE Navigator)
19736351 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
17506987 postsynaptic density-93 and N-methyl-D-aspartate receptors subunits 2B mRNA are upregulated in temporal lobe tissue of epilepsy
16640776 identifies new isoform of DLG2 gene, which contains 3'-end exons of the known DLG2 gene along with the hypothetical gene FLJ37266; new isoform is specifically upregulated in renal oncocytoma
15304517 Coexpression of Kir2.1 and PSD-93delta had no discernible effect upon channel kinetics but resulted in cell surface Kir2.1 clustering and suppression of channel internalization.

AA Sequence

MFFACYCALRTNVKKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLSQIENVHGYVLQSHISPLKAS      1 - 70
PAPIIVNTDTLDTIPYVNGTEIEYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAE     71 - 140
DGRLRVNDCILRVNEVDVSEVSHSKAVEALKEAGSIVRLYVRRRRPILETVVEIKLFKGPKGLGFSIAGG    141 - 210
VGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTHEEAVAILKNTSEVVYLKVGKPT    211 - 280
TIYMTDPYGPPDITHSYSPPMENHLLSGNNGTLEYKTSLPPISPGRYSPIPKHMLVDDDYTRPPEPVYST    281 - 350
VNKLCDKPASPRHYSPVECDKSFLLSAPYSHYHLGLLPDSEMTSHSQHSTATRQPSMTLQRAVSLEGEPR    351 - 420
KVVLHKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELQRGDQILSVNGIDLRGASHEQAAAALKGA    421 - 490
GQTVTIIAQYQPEDYARFEAKIHDLREQMMNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGL    491 - 560
SFKYGDILHVINASDDEWWQARRVMLEGDSEEMGVIPSKRRVERKERARLKTVKFNAKPGVIDSKGSFND    561 - 630
KRKKSFIFSRKFPFYKNKEQSEQETSDPERGQEDLILSYEPVTRQEINYTRPVIILGPMKDRINDDLISE    631 - 700
FPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVRFVAERGK    701 - 770
HCILDVSGNAIKRLQVAQLYPIAIFIKPRSLEPLMEMNKRLTEEQAKKTYDRAIKLEQEFGEYFTAIVQG    771 - 840
DTLEDIYNQCKLVIEEQSGPFIWIPSKEKL                                            841 - 870
//

Text Mined References (61)

PMID Year Title
26460480 2015 Expression analysis in a rat psychosis model identifies novel candidate genes validated in a large case-control sample of schizophrenia.
25064009 2014 Large-scale meta-analysis of genome-wide association data identifies six new risk loci for Parkinson's disease.
25008200 2014 Genome wide association scan for chronic periodontitis implicates novel locus.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23519667 2013 Interaction partners of PSD-93 studied by X-ray crystallography and fluorescence polarization spectroscopy.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23201973 2013 Synaptic scaffold evolution generated components of vertebrate cognitive complexity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22544364 2012 A genome-wide association study identifies susceptibility loci for Wilms tumor.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21119615 2011 DGK? regulates presynaptic release during mGluR-dependent LTD.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20054121 2009 Structure of the first PDZ domain of human PSD-93.
19931931 2010 Evaluation of DLG2 as a positional candidate for disposition index in African-Americans from the IRAS Family Study.
19807924 2009 Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening.
19736351 2009 Recurrent rearrangements in synaptic and neurodevelopmental genes and shared biologic pathways in schizophrenia, autism, and mental retardation.
19570815 2009 A genome-wide association study of northwestern Europeans involves the C-type natriuretic peptide signaling pathway in the etiology of human height variation.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
19118189 2008 Preso, a novel PSD-95-interacting FERM and PDZ domain protein that regulates dendritic spine morphogenesis.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17903296 2007 Genome-wide association with bone mass and geometry in the Framingham Heart Study.
17506987 2007 Upregulated expression of postsynaptic density-93 and N-methyl-D-aspartate receptors subunits 2B mRNA in temporal lobe tissue of epilepsy.
17384233 2007 Structure of PICK1 and other PDZ domains obtained with the help of self-binding C-terminal extensions.
17052657 2006 Genome-wide genotyping in Parkinson's disease and neurologically normal controls: first stage analysis and public release of data.
16640776 2006 Differential expression of a new isoform of DLG2 in renal oncocytoma.
16630835 2006 SALM synaptic cell adhesion-like molecules regulate the differentiation of excitatory synapses.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16192269 2005 Purification of ATP-binding cassette transporter A1 and associated binding proteins reveals the importance of beta1-syntrophin in cholesterol efflux.
15304517 2004 An alternatively spliced isoform of PSD-93/chapsyn 110 binds to the inwardly rectifying potassium channel, Kir2.1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12713445 2003 Selective interaction of megalin with postsynaptic density-95 (PSD-95)-like membrane-associated guanylate kinase (MAGUK) proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445884 2002 Expression, regulation and role of the MAGUK protein SAP-97 in human atrial myocardium.
12421351 2002 Selective reduction of a PDZ protein, SAP-97, in the prefrontal cortex of patients with chronic schizophrenia.
12351654 2002 Identification of multiple binding partners for the amino-terminal domain of synapse-associated protein 97.
12070168 2002 Selective binding of synapse-associated protein 97 to GluR-A alpha-amino-5-hydroxy-3-methyl-4-isoxazole propionate receptor subunit is determined by a novel sequence motif.
11997254 2002 Inward rectifier K+ channel Kir2.3 is localized at the postsynaptic membrane of excitatory synapses.
11771761 2001 Fetal life in Down syndrome starts with normal neuronal density but impaired dendritic spines and synaptosomal structure.
11572861 2001 Guanylyl cyclase/PSD-95 interaction: targeting of the nitric oxide-sensitive alpha2beta1 guanylyl cyclase to synaptic membranes.
11274188 2001 Plasma membrane Ca2+-atpase isoforms 2b and 4b interact promiscuously and selectively with members of the membrane-associated guanylate kinase family of PDZ (PSD95/Dlg/ZO-1) domain-containing proteins.
11095503 2000 Postsynaptic targeting of MAGUKs mediated by distinct N-terminal domains.
10725395 2000 The neuregulin receptor ErbB-4 interacts with PDZ-containing proteins at neuronal synapses.
10648730 2000 A developmental change in NMDA receptor-associated proteins at hippocampal synapses.
10197530 1999 Synaptic targeting of the postsynaptic density protein PSD-95 mediated by lipid and protein motifs.
9806853 1998 Fine-scale physical map of the 11q21 region surrounding the human DLG2 locus, the gene encoding Chapsyn-110.
9786987 1998 Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A.
9753324 1998 A tripartite protein complex with the potential to couple synaptic vesicle exocytosis to cell adhesion in brain.
9677374 1998 SAP97 is associated with the alpha-amino-3-hydroxy-5-methylisoxazole-4-propionic acid receptor GluR1 subunit.
9581762 1998 CRIPT, a novel postsynaptic protein that binds to the third PDZ domain of PSD-95/SAP90.
9278515 1997 Binding of neuroligins to PSD-95.
9182804 1997 Disulfide-linked head-to-head multimerization in the mechanism of ion channel clustering by PSD-95.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8755482 1996 Heteromultimerization and NMDA receptor-clustering activity of Chapsyn-110, a member of the PSD-95 family of proteins.
8625413 1996 Interaction of nitric oxide synthase with the postsynaptic density protein PSD-95 and alpha1-syntrophin mediated by PDZ domains.
7477295 1995 Clustering of Shaker-type K+ channels by interaction with a family of membrane-associated guanylate kinases.