Property Summary

NCBI Gene PubMed Count 16
PubMed Score 7.89
PubTator Score 5.52

Knowledge Summary

Patent

No data available

TINX Plot

Expression

 Compartment GO Term (0)

Gene RIF (4)

AA Sequence

MASPAPLVASISHQMVALQTLQLLQQEWGWGDGPVAPGNPRDPDHVSTAPARRSGPPRARPGPGREERGG      1 - 70
GVGTRSRRTAARANSPEEEVVRGAEGGAELLPFPRDRGPCTLAQMAMRSALARVVDSTSELVSVEQTLLG     71 - 140
PLQQERSFPIHLKDSVEFRNICSHLALQIEGQQFDRDLNAAHQCLKTIVKKLIQSLANFPSDAHMVACAS    141 - 210
LRQILQNLPDI                                                               211 - 221
//

Text Mined References (16)

PMID Year Title