Property Summary

NCBI Gene PubMed Count 14
PubMed Score 64.90
PubTator Score 3.42

Knowledge Summary

Patent

No data available

Synonym

Accession O43261 Q547G6 Q8TE10 Q96QY5
Symbols BCMS
DLB1
LEU1
LEU2
XTP6
BCMS1
DLEU2
LINC00021
NCRNA00021

Gene

 Compartment GO Term (2)

Gene RIF (4)

AA Sequence

MRPCIWIHVHLKPPCRLVELLPFSSALQGLSHLSLGTTLPVILPERNEEQNLQELSHNADKYQMGDCCKE      1 - 70
EIDDSIFY                                                                   71 - 78
//

Text Mined References (16)

PMID Year Title