Property Summary

NCBI Gene PubMed Count 14
PubMed Score 53.79
PubTator Score 3.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Synonym

Accession O43261 Q547G6 Q8TE10 Q96QY5
Symbols BCMS
DLB1
LEU1
LEU2
XTP6
BCMS1
DLEU2
LINC00021
NCRNA00021

Gene

 Compartment GO Term (2)

Gene RIF (4)

PMID Text
23593011 we describe an example where two lncRNA genes (DLEU1 and DLEU2) are epigenetically deregulated together with a cluster of neighboring protein-coding tumor suppressor genes in almost all patients suffering from chronic lymphocytic leukemia
19347735 propose that the underlying pathomechanism of CLL involves co-regulation of miRNA genes miR-16-1 and miR-15a by the two long non-coding RNA genes DLEU1 and DLEU2.
19260139 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
11406609 Leu1 seems to be only one of the smallest splicing variants of a large gene termed BCMS.

AA Sequence

MRPCIWIHVHLKPPCRLVELLPFSSALQGLSHLSLGTTLPVILPERNEEQNLQELSHNADKYQMGDCCKE      1 - 70
EIDDSIFY                                                                   71 - 78
//

Text Mined References (16)

PMID Year Title
23593011 2013 Epigenetic upregulation of lncRNAs at 13q14.3 in leukemia is linked to the In Cis downregulation of a gene cluster that targets NF-kB.
22424883 2012 Genome-wide association study of lung function decline in adults with and without asthma.
22190364 2011 Genome-wide meta-analysis identifies novel multiple sclerosis susceptibility loci.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
20351715 2011 Meta-analysis of genome-wide association data of bipolar disorder and major depressive disorder.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
19347735 2009 Chronic lymphocytic leukemia and 13q14: miRs and more.
19260139 2009 Genome-wide association study of anthropometric traits in Korcula Island, Croatia.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11406609 2001 B-cell neoplasia associated gene with multiple splicing (BCMS): the candidate B-CLL gene on 13q14 comprises more than 560 kb covering all critical regions.
11161783 2000 Comparative sequence analysis of a region on human chromosome 13q14, frequently deleted in B-cell chronic lymphocytic leukemia, and its homologous region on mouse chromosome 14.
9395242 1997 Cloning of two candidate tumor suppressor genes within a 10 kb region on chromosome 13q14, frequently deleted in chronic lymphocytic leukemia.