Property Summary

NCBI Gene PubMed Count 15
PubMed Score 148.38
PubTator Score 29.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 3.3e-06
osteosarcoma 7950 6.8e-05
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 3.0
Disease Target Count Z-score Confidence
Rectum cancer 12 5.687 2.8

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.245 6.8e-05
psoriasis -1.100 3.3e-06

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MGEASPPAPARRHLLVLLLLLSTLVIPSAAAPIHDADAQESSLGLTGLQSLLQGFSRLFLKGNLLRGIDS      1 - 70
LFSAPMDFRGLPGNYHKEENQEHQLGNNTLSSHLQIDKMTDNKTGEVLISENVVASIQPAEGSFEGDLKV     71 - 140
PRMEEKEALVPIQKATDSFHTELHPRVAFWIIKLPRRRSHQDALEGGHWLSEKRHRLQAIRDGLRKGTHK    141 - 210
DVLEEGTESSSHSRLSPRKTHLLYILRPSRQL                                          211 - 242
//

Text Mined References (15)

PMID Year Title