Property Summary

NCBI Gene PubMed Count 25
PubMed Score 23.92
PubTator Score 26.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 2.1e-59
lung carcinoma 2844 6.8e-08
lung cancer 4473 2.3e-06

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 5.500 2.3e-06
lung carcinoma 1.700 6.8e-08
psoriasis 3.100 2.1e-59

Protein-protein Interaction (4)

Gene RIF (20)

PMID Text
26419038 The recurrence of benign tumors of mammary gland occurred predominantly in women-carriers of mutant alleles with polymorphism rs8190924 of gene GSR and AA rs3763511of gene DKK4.
23958302 DKK4 upregulated by T3/TR antagonizes the Wnt signal pathway to suppress tumor cell progression
23516639 rs3923086 in AXIN2 and rs3763511 in DKK4 that did not show any association in the overall population were significantly associated with early on-set and estrogen receptor negative breast cancers, respectively.
23108157 It would appear that deregulation of the WNT pathway by overexpression of DKK4 may further impair WNT signaling and lead to Anorectal malformations.
22740476 Found the unique expression of the Wnt antagonist DKK4 in SW480APC, but not parental SW480 cell-derived exosomes. Upregulation of DKK4 in SW480APC cells was confirmed by RT-PCR, immunoblotting, and immunogold electron microscopy.
22249261 Our findings suggest a potential tumour suppressive role of DKK4 as well as that of an important regulator of HCC.
22216841 TFAP2E hypermethylation is associated with clinical nonresponsiveness to chemotherapy in colorectal cancer. Functional assays confirm that TFAP2E-dependent resistance is mediated through DKK4.
21994129 The TR/DKK4/Wnt/beta-catenin cascade influences the proliferation and migration of hepatoma cells during the metastasis process and support a tumor suppressor role of the thyroid hormone receptor.
21341386 Polymorphism of DKK4 was significantly associated with brain volume in Chinese individuals.
20650998 DKK1 and DKK4 proteins are expressed in the lung epithelium in idiopathic pulmonary fibrosis
19773279 Observational study of gene-disease association. (HuGE Navigator)
19659606 Dickkopf-4 and -2 are significantly upregulated in most colorectal tumors
19562778 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19059704 DKK4 is an important negative regulator of colon cancer cell growth.
18461655 Down-regulation of the Dkks associated to promoter hypermethylation appears to be frequently involved in gastrointestinal tumorigenesis.
18408752 DICKKOPF-4 is induced by TCF/beta-catenin and upregulated in human colon cancer, promotes tumour cell invasion and angiogenesis.
17553464 Observational study of gene-disease association. (HuGE Navigator)
17553464 DKK4 may play a role in schizophrenia pathogenesis
11701963 chromosome 8 mapping by FISH

AA Sequence

MVAAVLLGLSWLCSPLGALVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCATCRGLR      1 - 70
RRCQRDAMCCPGTLCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQ     71 - 140
EGESCLRTFDCGPGLCCARHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCGPGLLCRSQLTSNR    141 - 210
QHARLRVCQKIEKL                                                            211 - 224
//

Text Mined References (26)

PMID Year Title
26419038 2015 [MODERN METHODS OF PROGNOSTICATION OF THE RECURRENCES OCCURRENCE AFTER SURGICAL TREATMENT OF THE MAMMARY GLAND BENIGN TUMORS].
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
23958302 2013 Thyroid hormone receptor inhibits hepatoma cell migration through transcriptional activation of Dickkopf 4.
23516639 2013 Association of single nucleotide polymorphisms in Wnt signaling pathway genes with breast cancer in Saudi patients.
23108157 2013 Genome-wide copy number variation study in anorectal malformations.
22740476 2012 Restoration of full-length APC protein in SW480 colon cancer cells induces exosome-mediated secretion of DKK-4.
22249261 2012 Dickkopf 4 (DKK4) acts on Wnt/?-catenin pathway by influencing ?-catenin in hepatocellular carcinoma.
22216841 2012 TFAP2E-DKK4 and chemoresistance in colorectal cancer.
21994129 2012 Dickkopf 4 positively regulated by the thyroid hormone receptor suppresses cell invasion in human hepatoma cells.
21341386 2011 [Association of the schizophrenia susceptible gene DKK4 with brain volume in Chinese populations].
20650998 2011 Dickkopf proteins influence lung epithelial cell proliferation in idiopathic pulmonary fibrosis.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19659606 2009 DICKKOPF-4 and -2 genes are upregulated in human colorectal cancer.
19562778 2009 Wnt antagonist gene polymorphisms and renal cancer.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19059704 2009 Dickkopf-4 is frequently down-regulated and inhibits growth of colorectal cancer cells.
18461655 2008 Transcriptional silencing of Dickkopf gene family by CpG island hypermethylation in human gastrointestinal cancer.
18408752 2008 DICKKOPF-4 is induced by TCF/beta-catenin and upregulated in human colon cancer, promotes tumour cell invasion and angiogenesis and is repressed by 1alpha,25-dihydroxyvitamin D3.
17553464 2008 Positional pathway screen of wnt signaling genes in schizophrenia: association with DKK4.
17143291 2006 Function and biological roles of the Dickkopf family of Wnt modulators.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
12527209 2003 Kremen2 modulates Dickkopf2 activity during Wnt/LRP6 signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11701963 2001 Assignment of the human dickkopf (Xenopus) homolog 4 (DKK4) to chromosome 8p11.2-->p11.1 by fluorescence in situ hybridization.
10570958 1999 Functional and structural diversity of the human Dickkopf gene family.