Property Summary

NCBI Gene PubMed Count 106
PubMed Score 149.93
PubTator Score 463.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
nephrosclerosis 1.280 2.9e-03
urothelial carcinoma 3.000 1.4e-05
astrocytic glioma -2.300 1.1e-02
psoriasis -1.800 2.6e-04
glioblastoma -1.200 2.1e-02
oligodendroglioma -1.600 5.3e-10
osteosarcoma 2.569 4.2e-04
group 4 medulloblastoma -3.000 4.8e-07
atypical teratoid / rhabdoid tumor -2.700 2.2e-07
medulloblastoma, large-cell -4.500 1.7e-06
Duchenne muscular dystrophy 1.270 4.4e-08
autosomal dominant Emery-Dreifuss muscul... 1.464 3.0e-03
juvenile dermatomyositis 1.206 5.0e-07
adrenocortical carcinoma -2.720 3.4e-04
tuberculosis -3.400 1.1e-05
primary pancreatic ductal adenocarcinoma 2.752 1.3e-04
intraductal papillary-mucinous adenoma (... -1.800 8.3e-03
intraductal papillary-mucinous carcinoma... -2.300 3.3e-02
intraductal papillary-mucinous neoplasm ... -2.200 3.9e-02
lung cancer -2.300 5.0e-06
pancreatic cancer 3.000 8.8e-05
cystic fibrosis 1.200 5.3e-04
lung adenocarcinoma -2.000 3.1e-11
Breast cancer -3.000 9.8e-15
invasive ductal carcinoma 1.189 3.3e-03
nasopharyngeal carcinoma 1.200 8.8e-03
breast carcinoma -1.400 1.0e-21
ulcerative colitis 2.000 8.3e-04
ovarian cancer -2.600 1.1e-04
pituitary cancer -1.600 4.7e-03
dermatomyositis 1.600 9.3e-03

 CSPA Cell Line (3)

Gene RIF (85)

PMID Text
27010856 these data suggest that downregulation of tubular beta-catenin signaling induced by Dkk-3 has a detrimental role in chronic proteinuria, partially through the increase in apoptosis.
26689513 first report documenting that DKK3 polymorphisms are not only associated with prostate cancer but also related to prostate cancer-related factors.
26503968 Observations highlight a role for Dkk-3 in modulating TGF-beta/MMP signals in the prostate and prostate cancer.
26397159 Down-regulation of Dkk3 is associated with recurrence in Endometrioid Adenocarcinoma.
26278164 beta2M-mediated VEGFR-2/Akt/mTOR phosphorylation and tumor angiogenesis was significantly suppressed by over-expression of DKK-3.
26119087 we propose that Dickkopf-related protein-3 (Dkk-3) might be a novel Amyloid-beta (Abeta) associated protein
26093488 Suggest that DKK3 may be important in mediating invasion in esophageal adenocarcinoma.
25823913 REIC/Dkk-3 is a naturally circulating serum protein, the upregulation REIC/Dkk-3 protein expression could be a promising option for cancer therapy
25760729 Epigenetic downregulation of DKK3 leads to docetaxel resistance in human nonsmall cell lung cancer (NSCLC) cells.
25604390 Loss of DKK3 protein expression was significantly associated with poor survival in patients with gastric cancer and was strongly correlated with the TNM stage.
25573172 reactivation of Dkk3 enhances the chemosensitivity to cisplatin in cisplatinresistant lung adenocarcinoma cell lines
25514350 Dkk-3 has a tumor-suppressive function and a proapoptotic effect, inducing apoptosis through mitochondrial and Fas death receptor pathways in human mucinous ovarian cancer MCAS cells.
25344678 In the process of HCC, the abnormal activity of Wnt/b-catenin signaling may be associated with the methylation of Dkk-1 and Dkk-3.
25301448 Loss of DKK3 expression is associated with glioblastoma.
24909558 Findings suggest that Dkk-3 plays a role in the regulation of cell interactions during retinoic acid-induced neuronal differentiation; effect on apoptosis was also observed upon expression of the related protein Dkkl-1
24743782 The results suggested that the lack of affinity between human DKK3 and human LRP5/6 results from: i) insertion of the 7 amino acids, and ii) P258 in human DKK3.
24676838 a decrease in Dkk1 and Dkk3 mRNA and protein levels was observed in the ccRCC tissues. The serum Dkk1 and Dkk3 levels in the patients with ccRCC were found to be significantly lower than those in the controls.
24498395 Loss of REIC expression is associated withnon-small cell lung cancer.
24325785 data indicates that miR-92b directly regulate cell proliferation and apoptosis by targeting DKK3 and act as prognostic factors for glioma patients
24309205 Dkk3 levels corrected to platelet count showed higher levels in polycythemia vera patients than normal controls. Elevated Dkk3c level could possibly correlate to platelet activation in polycythemia vera patients and increased Dkk3 release.
23765731 elevated Dkk-3 in the stroma of the diseased prostate presumably regulates stromal remodeling by enhancing proliferation and differentiation of stromal cells and contributing to the angiogenic switch observed in BPH and prostate cancer.
23702469 DKK3 gene is a potential tumor suppressor gene in thyroid cancer, and aberrant promoter methylation is an important mechanism for its downregulation, which may play a role in the tumorigenesis and aggressiveness of papillary thyroid carcinoma.
23567267 DKK3 downregulation across all MB subgroups may be due to epigenetic mechanisms, in particular, through chromatin condensation.
23538390 Data identifies Dkk-3 and SMAD4 as potential target genes of miR-183 in prostate cancer.
23529184 We developed a protocol to generate smooth muscle cells from pluripotent stem cells through a dickkopf 3 signaling pathway, useful for generating tissue-engineered vessels.
23354949 These data demonstrated that Dkk-3 expression in OSCC was different than that in adenocarcinomas. Dkk-3 may possess an oncogenic function that is independent of Wnt signaling.
23320751 Tumor-specific methylation of the three-gene panel (ITIH5, DKK3, and RASSF1A) might be a valuable biomarker for the early detection of breast cancer.
23154266 Decreased DKK3 expression was associated with advanced International Federation of Gynecology and Obstetrics clinical stages and was predictive of lower disease-free survival in patients with cervical squamous cell carcinoma.
22555103 Dkk3 gene expression is frequently downregulated in endometrial cancer, and is associated with poor prognostic clinicopathologic markers. Results identify a role for Dkk3 as a tumor suppressor in EC, affecting both proliferation and invasiveness.
22529687 Dkk-3 overexpression induced apoptosis in human colon cancer possibly through the mitochondrial pathway. Dkk-3 may be involved in the Wnt/beta-catenin signaling pathways in colon cancer.
22473694 Study indicates that down-regulated REIC expression might play an important role in colorectal adenoma-adenocarcinoma sequence and subsequent progression.
22421143 aberrant expression of REIC might play some role in growth and lymph node metastasis of gastric carcinoma by suppressing growth, migration and invasion and/or by inducing apoptosis
22274868 REIC/Dkk-3 type-a methylation was frequently detected in a broad range of cancers and appeared to play a key role in silencing REIC/Dkk-3 type-a expression in these malignancies.
22076283 Five bladder cancer cell lines among six cell lines examined were resistant to adenovirus-Dkk-3.
22071168 The suitability of Dkk-3 as a diagnostic biomarker for prostate cancer (PCa) in seminal plasma (SP), was investigated.
21987623 Results implicate Dickkopf3 as a tumor suppressor in human pancreatic cancer, through the downregulation of beta-catenin expression via the ERK-mediated pathway.
21932035 A change in Dkk-3 localization during the transformation of normal oral epithelium to SCC was clearly observed.
21879258 Dkk-3 is required to maintain a highly dedifferentiated and consequently proliferative state in PANC-1, indicating a similar function in the Dkk-3 overexpressing subset of PDACs.
21835165 A link between REIC/Dkk- 3 and Tctex-1 may therefore be of significance for understanding the molecular functions of the proteins in ER stress signaling and the intracellular dynein motor dynamics, respectively.
21796842 The REIC content was lower in supernatant from gastric carcinoma cells than that in epithelial cells
21796614 study demonstrates that the MYCN-induced downregulation of Dickkopf-3 (DKK3) results from direct upregulation of miR-17-92 components effecting both DKK3 mRNA stability
21572098 data demonstrate that MYCN-regulated miRNAs are able to modulate the expression of the tumor suppressor DKK3 in neuroblastoma
21323747 Dkk-3 is expressed in human and mouse epidermis at the interface of upper spinous layer and granular layer. Dkk-3 expression is down-regulated in the hyperproliferative epidermis including skin cancers and non-cancerous proliferative diseases.
21042779 Analyzed the internalization of Cy3-labeled recombinant REIC/Dkk-3 protein. Among the cell lines screened, mouse induced pluripotent stem (iPS) cells showed a unique pattern of internalization.
21042718 REIC/Dkk-3 may play a role in regulating the morphological process of normal tissue architecture through an autocrine and/or paracrine manner.
20978717 Dkk3+ megakaryocytes correlated with microvessel density in PV and PMF; Dkk3 might be involved in the pathogenesis of myeloproliferative neoplasms.
20811686 This study suggests that a cause of catenin delocalization in oral cancer could be due to WNT pathway activation, by epigenetic alterations of SFRP-1, SFRP-2, SFRP-4, SFRP-5, WIF-1, DKK-3 genes
20666943 Dkk-3 protein detection using enzyme-linked immunosorbent assay as molecular markers can contribute to detection and diagnosis of gynecological cancer, especially for ovarian cancer and endometrial cancer.
20627041 Upregulation of Dkk-3 expression in esophageal squamous cell carcinoma may contribute to tumor invasion and metastasis.
20616171 genetic variation of DKK3 may modify severity of autosomal dominant polycystic kidney disease resulting from PKD1 mutations.
20616171 Observational study of gene-disease association. (HuGE Navigator)
20532910 DKK3 mRNA expression was reduced in 63% (35 of 56) of tumors compared with normal ovarian samples
20514419 Results indicate that DKK3 acts as an antiapoptotic molecule by decreasing the intracellular level of reactive oxygen species.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20050020 DKK3 is preferentially expressed by human bulge cells, compared to differentiated hair follicle keratinocytes
19859801 Loss of DKK3 by methylation is associated with breast cancer.
19570204 Wnt antagonist genes WIF1 and DKK3 show a very similar frequency of promoter methylation in human breast cancer, but only DKK3 methylation proves as a novel prognostic marker
19562778 Observational study of gene-disease association. (HuGE Navigator)
19496188 Data suggest that aberrant promoter methylation and decreased expression of DKK-3 and WIF-1 may be an important mechanism in hepatocellular carcinoma, and may be useful for early diagnosis and therapy of HCC.
19493271 DKK-3 expression in tumor endothelium: a novel prognostic marker of pancreatic adenocarcinomas.
19457090 Elevated Dkk-3 levels are specifically associated with Alzheimer's disease (AD) and may serve as a potential non-invasive AD biomarker in plasma.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19437037 assessment of Dkk3 and AFP may be useful in the diagnosis of hepatic tumors.
19279003 These results indicate that adenovirus-REIC has another arm against human cancer, an indirect host-mediated effect because of overproduction of IL-7 by mis-targeted normal human fibroblasts, in addition to its direct effect on cancer cells.
19192722 Dkk-3 can play a role in head and neck squamous cell carcinoma (HNSCC) carcinogenesis with unknown mechanism. Allelic loss at Dkk-3 locus may also be used as a novel prognostic biomarker in HNSCC.
19051296 Epigenetic silencing of the Dkk-3 gene by promoter methylation was a common event in gastric cancer and was associated with a poor outcome in such patients.
19003969 Dkk3 is a negative regulator of beta-catenin and its downregulation contributes to an activation of the beta-catenin signaling pathway
18922905 both ATF3 and Smad were crucially and synergistically involved in down-regulation of Id-1, which regulated JNK phosphorylation in REIC/Dkk-3-induced apoptosis.
18826564 Aberrant methylation of the DKK3 promoter downregulates mRNA & protein expression in human breast cancer development. It may be a tumor suppressor in normal breast tissue.
18654608 REIC/Dkk-3 overexpression downregulates P-glycoprotein in multidrug-resistant MCF7/ADR cells and induces apoptosis in breast cancer
18461655 Down-regulation of the Dkks associated to promoter hypermethylation appears to be frequently involved in gastrointestinal tumorigenesis.
18443132 REIC/Dkk-3 plays a pivotal role in the biology of human malignant glioma and suggests that REIC/Dkk-3 is a promising candidate for molecular target therapy.
18247400 Dkk-3 expression in normal epithelium of the prostate is lost during benign and malignant transformation and differentiation. The loss of expression is counterbalanced by upregulation of Dkk-3 expression in the blood vessels of the remodeled tissue.
18059033 High DKK3 expression in benign ganglioneuromas and down-regulation of DKK3 by MYCN in neuroblastoma might contribute to the strongly different clinical behavior of both neuroblastic tumor types. MYCN expression is inversely correlated with that of DKK3.
18048388 Ectopic expression of Dkk3 in lung cancer cells with Dkk3 hypermethylation induced apoptosis and inhibited TCF-4 activity as well as nuclear accumulation of beta-catenin and expression of TCF-4 targets c-Myc and cyclin D1
18033687 Stable overexpression of murine Dkk-3 in B16F10 cells significantly increased microvessel density in a melanoma model. We postulate a novel function of Dkk-3 in endothelial cells as a differentiation factor involved in remodeling the tumor vasculature.
17347849 Dkk-3 mRNA and protein are clearly present in adult human pancreatic islets.
16981135 These data show that DKK3 and WNT4 have multiple actions on steroidogenesis in adrenocortical cells, including effects on overall steroidogenesis (aldosterone and cortisol biosynthesis) and distinct effects on steroidogenic enzyme mRNA levels.
16751809 Loss of Dkk-3 expression resulting in impairment of glandular structure and uncontrolled prostate epithelial cell (PrEC) proliferation, both of which are crucial for prostate cancer progression.
16609023 The methylation level of DKK3 protein was significantly higher and mRNA level wassignificantly lower in bladder tumor than in bladder mucosa.
16568085 loss of DKK expression plays a role in development or progression of malignant melanoma
15998302 Down-regulation of Dickkopf 3 in elderly schizophrenic subjects.
15516983 Dkk-3/REIC functions as a suppressor for human tumor growth
15087387 Transfection of Dkk-3 and dominant-negative LRP5 into osteosarcoma cells significantly reduces invasion capacity and cell motility.
11814687 REIC gene expression was decreased in 14 of 24 fresh non-small cell lung cancer specimens (58%) compared to that in corresponding non-cancerous tissue.

AA Sequence

MQRLGATLLCLLLAAAVPTAPAPAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMEDTQHKLRSAVE      1 - 70
EMEAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITNNQTGQMVFSETVITSVGDEE     71 - 140
GRRSHECIIDEDCGPSMYCQFASFQYTCQPCRGQRMLCTRDSECCGDQLCVWGHCTKMATRGSNGTICDN    141 - 210
QRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALDRCPCASGLLCQPHSHSL    211 - 280
VYVCKPTFVGSRDQDGEILLPREVPDEYEVGSFMEEVRQELEDLERSLTEEMALREPAAAAAALLGGEEI    281 - 350
//

Text Mined References (110)

PMID Year Title
27010856 2016 Downregulation of renal tubular Wnt/?-catenin signaling by Dickkopf-3 induces tubular cell death in proteinuric nephropathy.
26689513 Single nucleotide polymorphisms in DKK3 gene are associated with prostate cancer risk and progression.
26503968 2016 Dickkopf-3 regulates prostate epithelial cell acinar morphogenesis and prostate cancer cell invasion by limiting TGF-?-dependent activation of matrix metalloproteases.
26397159 2016 Expression Patterns of the Wnt Pathway Inhibitors Dickkopf3 and Secreted Frizzled-Related Proteins 1 and 4 in Endometrial Endometrioid Adenocarcinoma: An NRG Oncology/Gynecologic Oncology Group Study.
26278164 2015 Dickkopf-3 (DKK-3) obstructs VEGFR-2/Akt/mTOR signaling cascade by interacting of ?2-microglobulin (?2M) in ovarian tumorigenesis.
26119087 2015 Dickkopf-related protein 3 is a potential A?-associated protein in Alzheimer's Disease.
26093488 2015 The role of Dickkopf-3 overexpression in esophageal adenocarcinoma.
25823913 2015 The cysteine-rich core domain of REIC/Dkk-3 is critical for its effect on monocyte differentiation and tumor regression.
25760729 2015 DNA methylation of DKK3 modulates docetaxel chemoresistance in human nonsmall cell lung cancer cell.
25604390 2015 Aberrant loss of dickkopf-3 in gastric cancer: can it predict lymph node metastasis preoperatively?
25573172 2015 Dickkopf-3 (Dkk3) induces apoptosis in cisplatin-resistant lung adenocarcinoma cells via the Wnt/?-catenin pathway.
25514350 2015 Dkk-3 induces apoptosis through mitochondrial and Fas death receptor pathways in human mucinous ovarian cancer cells.
25344678 2015 Preliminary mechanism on the methylation modification of Dkk-1 and Dkk-3 in hepatocellular carcinoma.
25301448 2015 Blocking of the interaction between Wnt proteins and their co-receptors contributes to the anti-tumor effects of adenovirus-mediated DKK3 in glioblastoma.
24909558 2014 Dickkopf-3 alters the morphological response to retinoic acid during neuronal differentiation of human embryonal carcinoma cells.
24743782 2014 Molecular simulation analysis of the structure complex of C2 domains of DKK family members and ?-propeller domains of LRP5/6: explaining why DKK3 does not bind to LRP5/6.
24676838 2014 Decreased expression of Dkk1 and Dkk3 in human clear cell renal cell carcinoma.
24498395 2014 Anti-cancer effects of REIC/Dkk-3-encoding adenoviral vector for the treatment of non-small cell lung cancer.
24449494 2014 Dysfunction of Wnt signaling and synaptic disassembly in neurodegenerative diseases.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24325785 2013 MiR-92b inhibitor promoted glioma cell apoptosis via targeting DKK3 and blocking the Wnt/beta-catenin signaling pathway.
24309205 2014 Dkk3 levels in patients with myeloproliferative neoplasms.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23765731 2013 Dickkopf-related protein 3 promotes pathogenic stromal remodeling in benign prostatic hyperplasia and prostate cancer.
23702469 2013 DKK3 is a potential tumor suppressor gene in papillary thyroid carcinoma.
23567267 2013 Epigenetic Silencing of DKK3 in medulloblastoma.
23538390 2013 microRNA-183 is an oncogene targeting Dkk-3 and SMAD4 in prostate cancer.
23529184 2013 Smooth muscle cells differentiated from reprogrammed embryonic lung fibroblasts through DKK3 signaling are potent for tissue engineering of vascular grafts.
23354949 2013 Knockdown of Dkk-3 decreases cancer cell migration and invasion independently of the Wnt pathways in oral squamous cell carcinoma?derived cells.
23320751 2013 Promoter hypermethylation of the tumor-suppressor genes ITIH5, DKK3, and RASSF1A as novel biomarkers for blood-based breast cancer screening.
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
23154266 2013 Reduced expression of DKK3 is associated with adverse clinical outcomes of uterine cervical squamous cell carcinoma.
23006423 2012 Genetic association with overall survival of taxane-treated lung cancer patients - a genome-wide association study in human lymphoblastoid cell lines followed by a clinical association study.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22555103 2012 Expression of the Wnt antagonist Dickkopf-3 is associated with prognostic clinicopathologic characteristics and impairs proliferation and invasion in endometrial cancer.
22529687 2012 Overexpression of Dickkopf-3 induces apoptosis through mitochondrial pathway in human colon cancer.
22473694 2012 The clinicopathological significance of REIC expression in colorectal carcinomas.
22421143 2012 The roles of REIC gene and its encoding product in gastric carcinoma.
22274868 2012 DNA methylation status of REIC/Dkk-3 gene in human malignancies.
22076283 2012 Partial sensitization of human bladder cancer cells to a gene-therapeutic adenovirus carrying REIC/Dkk-3 by downregulation of BRPK/PINK1.
22071168 2011 Elevated levels of Dickkopf-related protein 3 in seminal plasma of prostate cancer patients.
21987623 2011 Dickkopf3 overexpression inhibits pancreatic cancer cell growth in vitro.
21932035 2011 Dickkopf (Dkk)-3 and ?-catenin expressions increased in the transition from normal oral mucosal to oral squamous cell carcinoma.
21879258 2012 Dickkopf-3 maintains the PANC-1 human pancreatic tumor cells in a dedifferentiated state.
21835165 2011 Tumor suppressor REIC/Dkk-3 interacts with the dynein light chain, Tctex-1.
21796842 2011 [The secreted level of REIC protein in gastric carcinoma and its role of proliferation inhibition].
21796614 2012 Dickkopf-3 is regulated by the MYCN-induced miR-17-92 cluster in neuroblastoma.
21572098 2011 MYCN-regulated miRNA-92 inhibits secretion of the tumor suppressor DICKKOPF-3 (DKK3) in neuroblastoma.
21323747 2011 Expression of REIC/Dkk-3 in normal and hyperproliferative epidermis.
21042779 2010 Internalization of REIC/Dkk-3 protein by induced pluripotent stem cell-derived embryoid bodies and extra-embryonic tissues.
21042718 2010 Expression pattern of REIC/Dkk-3 in various cell types and the implications of the soluble form in prostatic acinar development.
20978717 2011 Increased Dkk3 protein expression in platelets and megakaryocytes of patients with myeloproliferative neoplasms.
20811686 2010 WNT pathway in oral cancer: epigenetic inactivation of WNT-inhibitors.
20666943 2010 Clinical significance of serum Dkk-3 in patients with gynecological cancer.
20627041 2010 [Expression of Dickkopf-3 in esophageal squamous cell carcinoma].
20616171 2010 Genetic variation of DKK3 may modify renal disease severity in ADPKD.
20532910 2011 Expression of the Wnt antagonist DKK3 is frequently suppressed in sporadic epithelial ovarian cancer.
20514419 2010 Knockdown of the Dickkopf 3 gene induces apoptosis in a lung adenocarcinoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20050020 2009 Hedgehog signaling maintains hair follicle stem cell phenotype in young and aged human skin.
19859801 2010 Genomic screening for genes upregulated by demethylation revealed novel targets of epigenetic silencing in breast cancer.
19838169 2009 Enrichment of glycopeptides for glycan structure and attachment site identification.
19570204 2009 Prognostic relevance of Wnt-inhibitory factor-1 (WIF1) and Dickkopf-3 (DKK3) promoter methylation in human breast cancer.
19562778 2009 Wnt antagonist gene polymorphisms and renal cancer.
19496188 2009 Promoter methylation and mRNA expression of DKK-3 and WIF-1 in hepatocellular carcinoma.
19493271 2009 Dkk-3 expression in the tumor endothelium: a novel prognostic marker of pancreatic adenocarcinomas.
19457090 2009 Dkk-3 is elevated in CSF and plasma of Alzheimer's disease patients.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19437037 2009 Overexpression of Dickkopf 3 in hepatoblastomas and hepatocellular carcinomas.
19279003 2009 Overexpression of REIC/Dkk-3 in normal fibroblasts suppresses tumor growth via induction of interleukin-7.
19192722 2008 Deletion at Dickkopf (dkk)-3 locus (11p15.2) is related with lower lymph node metastasis and better prognosis in head and neck squamous cell carcinomas.
19051296 2009 Promoter methylation of the Wnt/beta-catenin signaling antagonist Dkk-3 is associated with poor survival in gastric cancer.
19003969 2009 Dkk3, downregulated in cervical cancer, functions as a negative regulator of beta-catenin.
18922905 2008 Down-regulation of inhibition of differentiation-1 via activation of activating transcription factor 3 and Smad regulates REIC/Dickkopf-3-induced apoptosis.
18826564 2008 Wnt signalling in human breast cancer: expression of the putative Wnt inhibitor Dickkopf-3 (DKK3) is frequently suppressed by promoter hypermethylation in mammary tumours.
18654608 2009 REIC/Dkk-3 overexpression downregulates P-glycoprotein in multidrug-resistant MCF7/ADR cells and induces apoptosis in breast cancer.
18461655 2008 Transcriptional silencing of Dickkopf gene family by CpG island hypermethylation in human gastrointestinal cancer.
18443132 2008 REIC/Dkk-3 induces cell death in human malignant glioma.
18247400 2008 Dysregulation of Dkk-3 expression in benign and malignant prostatic tissue.
18059033 2008 Dickkopf-3 expression is a marker for neuroblastic tumor maturation and is down-regulated by MYCN.
18048388 2008 Downregulation of Dkk3 activates beta-catenin/TCF-4 signaling in lung cancer.
18033687 2008 The Dickkopf-homolog 3 is expressed in tumor endothelial cells and supports capillary formation.
17347849 2007 Dickkopf-3 is expressed in a subset of adult human pancreatic beta cells.
17143291 2006 Function and biological roles of the Dickkopf family of Wnt modulators.
16981135 2006 Adenovirus-delivered DKK3/WNT4 and steroidogenesis in primary cultures of adrenocortical cells.
16751809 2006 Regulation of prostate cell growth and morphogenesis by Dickkopf-3.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16609023 2006 Combination analysis of hypermethylated Wnt-antagonist family genes as a novel epigenetic biomarker panel for bladder cancer detection.
16568085 2006 Expression of Dickkopf genes is strongly reduced in malignant melanoma.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15998302 2005 Down-regulation of Dickkopf 3, a regulator of the Wnt signalling pathway, in elderly schizophrenic subjects.
15516983 2004 Dickkopf-3/REIC functions as a suppressor gene of tumor growth.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15226763 2004 Transcriptional silencing of the Dickkopfs-3 (Dkk-3) gene by CpG hypermethylation in acute lymphoblastic leukaemia.
15087387 2004 Dickkopf 3 inhibits invasion and motility of Saos-2 osteosarcoma cells by modulating the Wnt-beta-catenin pathway.
14767340 2004 Decreased expression of REIC/Dkk-3 in human renal clear cell carcinoma.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12857724 2003 Functional characterization of WNT7A signaling in PC12 cells: interaction with A FZD5 x LRP6 receptor complex and modulation by Dickkopf proteins.
12844346 2003 Zonal expression of dickkopf-3 and components of the Wnt signalling pathways in the human adrenal cortex.
12527209 2003 Kremen2 modulates Dickkopf2 activity during Wnt/LRP6 signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11814687 2002 Reduced expression of the REIC/Dkk-3 gene by promoter-hypermethylation in human tumor cells.
10652205 2000 A REIC gene shows down-regulation in human immortalized cells and human tumor-derived cell lines.
10570958 1999 Functional and structural diversity of the human Dickkopf gene family.
9110174 1997 Large-scale concatenation cDNA sequencing.
9070656 1997 Identification of a novel gene product, RIG, that is down-regulated in human glioblastoma.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.