Property Summary

NCBI Gene PubMed Count 312
PubMed Score 552.45
PubTator Score 570.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 2.512 6.6e-03
esophageal adenocarcinoma -1.200 2.5e-02
cutaneous lupus erythematosus 1.900 4.3e-02
glioblastoma 2.600 5.2e-03
non diabetic and post-ischemic heart fai... -1.400 2.8e-02
non-small cell lung cancer 1.301 1.3e-03
lung cancer 7.800 2.1e-08
pancreatic cancer 3.500 9.2e-07
interstitial cystitis -2.500 1.4e-03
cystic fibrosis 1.200 2.1e-02
pediatric high grade glioma 1.900 1.9e-02
atypical teratoid/rhabdoid tumor 1.500 1.5e-02
group 3 medulloblastoma -1.700 3.4e-04
psoriasis -1.100 1.2e-04
ulcerative colitis 2.100 1.2e-02
chronic rhinosinusitis 1.139 1.6e-02

Protein-protein Interaction (7)

Gene RIF (280)

PMID Text
27015306 Through expression of the WNT inhibitor DKK1, latency competent cancer cells self-impose a slow-cycling state with broad downregulation of ULBP ligands for NK cells and evasion of NK-cell-mediated clearance.
26986465 AFP remained the best single marker, and the combined use of AFP with prothrombin precursor or DKK-1 had the best diagnostic performance compared to all other possible combinations of the four biomarkers, even in early stage hepatocellular carcinoma.
26927559 Data indicate that in rheumatoid arthritis patients, level of receptor activator of nuclear factor-kappaB ligand (RANKL) on T cells is elevated, and the serum level of RANKL increases, but Dickkopf1 protein (DKK1) decreases.
26782930 Synovial fibroblasts from patients with very early rheumatoid arthritis expressed significantly higher levels of DKK1 compared to patients with resolving arthritis.
26782539 Low DKK-1 serum levels are associated with poor prognosis in papillary thyroid cancer patients; DKK-1 could potentially be used as a biomarker leading to earlier diagnosis of papillary thyroid cancer.
26782465 High serum DKK-1 levels may be associated with tumor progression and poor prognosis in bladder cancer and may be used as a potential biomarker to predict the prognosis of patients with bladder cancer
26780085 DKK1 polymorphisms may correlate to baseline bone mineral density and serum beta-CTX levels, but present a weak effect on the response to alendronate.
26545120 SOST and DKK1 have opposing effects on PC3 cell invasion and bone-derived Wnt signaling positively contributes to the invasive phenotypes of PC3
26407843 Immunohistochemical analysis of DKK-1 expression in 97 breast cancer samples revealed that high expression of p38 was associated with a higher expression of DKK-1 compared to tumours with low p38 expression.
26400224 miR-152 blocked DKK1 transcriptional activity by binding to the 3'UTR of DKK1 mRNA.
26378045 DKK1 is found to be regulated by NBAT1 in a PRC2 dependent manner, and is responsible for NBAT1's effects in inhibiting migration and invasion of breast cancer cells.
26353782 We identified dickkopf related protein-1 as a possible marker of a cisplatin-refractory phenotype and as a potential novel therapeutic target to improve platinum response of non small cell lung carcinoma cells.
26297437 Dkk1 overexpression regulates beta-catenin signaling in Barrett's esophagus metaplastic but not in adenocarcinoma cells, suggesting that early perturbation of Dkk1-mediated signaling suppression may contribute to Barrett's esophagus malignant transformation
26256972 DKK-1 might be a key regulator in HCC [hepatocellular carcinoma ] progression and a potential therapeutic target in HCC.
26239269 DKK1 is associated with angiogenesis in the synovial fluid of patients with temporomandibular joint disorders
26125834 expression product was verified properly by western blotting using an anti-DKKI antibody. The successful cloning of the DKKI gene and expression of DKKI protein will be useful for studying the biological activity of tumorigenesis.
26101916 Suggest DKK1 may be a novel diagnostic/prognostic biomarker for pancreatic adenocarcinoma.
25974190 Serum Dkk-1 was associated with serum fibroblast growth factor 23 in patients undergoing peritoneal dialysis.
25941031 Dkk-1 production was strongly suppressed by IL6 and induced by TNF in the inflamed arthritic joint. Levels of Dkk-1 were similar in synovial fluid of both rheumatoid arthritis and spondyloarthritis patients.
25901391 DKK1 is differentially expressed amongst various non-small cell lung cancer cells.
25889943 Dkk-1 and deposition of calcium in aortic valve differ significantly in relation to the presence/absence of coronary atherosclerosis in patients with symptomatic calcified aortic stenosis.
25877354 results provided evidence for the role of Dkk-1 in bone metabolism and demonstrated the link of Dkk-1 and Wnt/beta-catenin in some ways
25873352 Study confirmed that decreased DKK1 in trophoblast tumor cell lines was related to promoter hypermethylation and showed that DKK1 was a tumor suppressor gene through wnt signaling pathway regulation.
25837853 higher levels in patients with Rheumatoid Arthritis, decrease correlates with response to Methotrexate therapy and improvement
25805736 There is no apparent genetic association of DKK-1 polymorphisms to rheumatoid arthritis structural severity and DKK-1 level of expression.
25788273 Findings demonstrate a novel location of DKK-1 within the cell nucleus and support a role of nuclear DKK-1 as a predictive biomarker of chemoresistance in colorectal cancer.
25694360 we observed for the first time that DKK1 serum levels are significantly increased in patients with indolent systemic mastocytosis
25652109 Serum levels of AFP, DKK1, and OPN were significantly elevated in patients with hepatocellular carcinoma.
25596857 Sclerostin and DKK-1 concentrations were markedly lower in HIV-infected youths
25550102 Two single nucleotide polymorphisms within the dickkopf-1 region accounted for nearly 5% of the variation in serum dickkopf-1
25487617 Further evaluation of the methylation of DACH1, DKK1, and WIF1 in a clinical patient group confirmed the frequent methylation of WIF1 and intermediate or low frequency of methylation of DACH1 or DKK1, respectively.
25484108 this study shows that short-term after SCI there is a marked increase in bone turnover and bone loss, the latter associated with an increase in Dkk-1 serum levels
25438096 In patients with rheumatoid arthritis, serum levels of DKK1 are significantly increased, correlate with PTH and are associated with increased risk of bone erosions and osteoporosis.
25436422 ox-LDL may induce DKK1 expression in macrophages to inhibit the accumulation of lipids through a mechanism that involves downregulation of LOX-1-mediated lipid uptake
25424899 The target genes of Wnt signaling pathway including CCND1, CCND2, FOSL1, DAB2 and JUN were also significantly enhanced expressed in human placenta tissue.
25422182 Serum DKK1 levels were found to be significantly upregulated in gastric cancer.
25369286 Circulating DKK1 levels are higher in type 2 diabetes mellitus with cardiovascular disease and are associated with an abnormal carotid intima media thickness in this cross-sectional study.
25351982 CBX7-mediated epigenetic induction of DKK-1 is crucial for the inhibition of breast tumorigenicity, suggesting that CBX7 could be a potential tumor suppressor in breast cancer.
25344678 In the process of HCC, the abnormal activity of Wnt/b-catenin signaling may be associated with the methylation of Dkk-1 and Dkk-3.
25319845 In this human study, a potential interesting non-synonymous variant was found in the DKK1 gene. Whether this variant plays a contributory role in the genesis of ARM or hypospadias would require a much larger study.
25291949 Serum functional DKK-1 levels showed an independent and negative correlation with radiographic severity of the disease in patients with ankylosing spondylitis.
25271869 Our results demonstrated that the Wnt pathway inhibitor DKK-1 was decreased in CLL. OPN was increased in NHL and associated with extranodal involvement.
25182503 Results show that DKK-1 protein levels are increased in prostate cancer tissue.
25144498 Elevated DKK1 levels associated with beta-catenin accumulation play a crucial role in chondrosarcoma. DKK1 can serve as a novel predictor of poor prognosis in patients with chondrosarcoma.
25037197 Circulating DKK-1 is increased in T2DM and associated with endothelial dysfunction and platelet activation.
24992617 Preoperative serum levels for DKK-1 seem to be a potential marker in prediction of tumor invasion and relapse in stage II-III colon cancer
24947038 In hepatitis C virus infected liver tissues hypermethylation at promoter regions of key cancer related genes SFRP2 and DKK1, appears early at chronic hepatitis and liver cirrhosis stages, long before the appearance of hepatocellular carcinoma.
24926963 the results of our genetic association analysis indicated that DKK1 may be a good candidate responsible for DDH development in the Chinese Han female population.
24916146 This study is the first to show the roles of Dickkopf-1 during the colorectal adenoma-carcinoma sequence, which may involve suppression of the tumorigenesis and angiogenesis of CRC.
24878698 Overexpression of DKK1 was correlated with metastatic and recurrent potential in patients with hepatocellular carcinoma after orthotopic liver transplantation.
24848709 Overexpression of BRAF(V600E) in normal thyroid epithelial (H tori) cells also reduced the effects of Dkk-1 on cell survival.
24834937 High DKK1 expression was significantly associated with tumor and clinical stage, lymph node metastasis, and tumor size (p < 0.05). Increased DKK1 levels in LSCC tissues correlated with elevated VEGF-C and beta-catenin.
24770633 The expression of DKK1 is hypoxia dependent in human malignant glioma cell lines.
24737523 DKK1 can be regarded as a marker gene for the risk of tooth agenesis.
24736728 evidence of lack of LRP5 mutations and of a putative HBM-causing mutation in DKK1
24733089 The reduced MITF level in monolayers might be partially explained by suppression of the Wnt/beta-catenin pathway, and DKK1, a secreted inhibitor of this pathway, was highly up-regulated in monolayers in comparison to melanospheres and original tumors.
24676838 a decrease in Dkk1 and Dkk3 mRNA and protein levels was observed in the ccRCC tissues. The serum Dkk1 and Dkk3 levels in the patients with ccRCC were found to be significantly lower than those in the controls.
24671437 Dickkopf1 (DKK1) protein, a secreted LRP6 ligand and antagonist, is also a modulator of anthrax toxin sensitivity. shRNA-mediated gene silencing or TALEN-mediated gene knockout of DKK1 reduced sensitivity of cells to PA-dependent hybrid toxins.
24612589 DKK-1 in serum was a good predictor of poor prognosis in patients with non-small cell lung cancer
24577091 Dkk-1 enhances resistance of osteosarcoma cells to stress by tipping balance of Wnt signaling in favor of the non-canonical Jun-mediated Wnt pathways. In turn, this results in transcriptional activation of ALDH1 through Jun-responsive promoter elements.
24481601 Suggest a significant role for Dkk1 and cellular senescence in esophageal tissue homeostasis during reflux esophagitis.
24471564 this study focused on the potential involvement of sclerostin and DKK-1 in the development of severe bone demineralization in young females with anorexia nervosa.
24469828 findings reveal that a defective FA pathway leads to up-regulation of DKK1, a molecule involved in hematopoietic malignancies
24444033 targeted directly by MSI1
24391982 Dickkopf-1 is oncogenic and involved in invasive growth in non small cell lung cancer.
24361889 DKK1 may be an important mechanistic link between non-small-cell lung cancer and bone metastases.
24325363 findings demonstrated that DKK1 promotes hepatocellular carcinoma cell migration and invasion at least partly by promoting beta-catenin/MMP7 signaling axis
24302746 increased DKK1 levels in patients with sclerosteosis and van Buchem disease represent an adaptive response to the increased bone formation characterizing these diseases. the increased levels do not compensate for the lack of sclerostin on bone formation.
24286177 Data indicate an inverse correlation between osteoarthritis and GREM1, FRZB and DKK1 gene expression.
24276456 In older men, lower serum DKK1 levels are associated with severe abdominal aortic calcinosis regardless of age and other potential confounders.
24269823 This study is the first to demonstrate that strict modulation of DKK1 expression in different cell types partially maintains cell survival via tight regulation of the ROS-producing ROMO1 and radiation resistance.
24250816 These data provide evidence for a role of DKK-1 in the pathogenesis of CD-associated perianal fistulae.
24227537 Data suggest that serum DKK1 and sclerostin levels are up-regulated in postmenopausal women with type 2 diabetes as compared to healthy control women; when DKK1/sclerostin levels are up-regulated, carotid intima-media thickness remains low.
24220876 The preoperative serum DKK-1 level was elevated in the esophageal squamous cell carcinoma patients.
24138842 No significant association between the studied DKK1 variations and osteoporosis was found, while CER1 variations seem to play a significant role in the determination of osteoporosis, combined with bone markers, in postmenopausal osteoporotic women.
24134157 Our studies demonstrated that HIV infection of astrocytes, despite minimal replication and a low number of infected cells, induces dysregulation of DKK1 secretion by a Cx43 hemichannel (HC)-dependent mechanism
24104453 Human umbilical cord-derived-Mesenchymal stem cells inhibited C6 glioma cell growth via secreting DKK1.
23922913 LSD1 activates the Wnt/beta-catenin signaling pathway by down-regulating the pathway antagonist DKK1, which may be one of the mechanisms leading to colorectal tumorigenesis.
23836157 A weak genetic association of a common variant of DKK1, rs1569198, which is located on a predicted new acceptor site for splicing of this gene, was observed in Paget disease of bone.
23752183 PTHrP was found to inhibit DKK1 expression through c-Jun-mediated inhibition of beta-catenin activity on the DKK1 promoter.
23702386 the association between circulating concentrations of Wnt inhibitors; DKK1 and sclerostin with bone mineral density (BMD), abdominal aortic calcification (AAC) and arterial stiffness in post-menopausal women, was investigated.
23698475 The DKK1 promoter region is hypermethylated in systemic sclerosis patients' fibroblasts and PBMCs compared to controls, leading to decreased DKK1 expression and aberrant Wnt signalling.
23636253 DKK1 and PTEN serve as competitive endogenous RNA, affecting the expression of each other via competition for miRNAs binding in the diabetic heart.
23600832 Serum DKK1 levels were significantly higher in unexplained recurrent spontaneous miscarriage (URSM) patients compared to controls; the expression of DKK1 mRNA and protein in decidua of URSM patients was also higher relative to healthy controls.
23595579 DKK-1 detection with ELISA as a biological marker can be used for the detection and diagnosis of cervical carcinoma. DKK-1 in serum is a good predictor of poor prognosis in patients with cervical cancer.
23546988 upregulated gene expression is associated with bone fragility in rheumatoid arthritis patients
23467116 Low Sclerostin and Dickkopf-1 levels were associated with a significantly increased risk of fluoride bone injury
23457386 RANKL/OPG ratio and DKK-1 expression differ in primary osteoblastic cultures from osteoarthritic and osteoporotic subjects.
23452984 DKK1 expression is significantly increased in preeclamptic placental tissues compared to normal controls.
23445914 DKK1 blood levels in healthy males subjected to bed rest for 14 days are decreased and increased at 21 days.
23396252 DKK1 promoter methylation may be a tumor-associated event in the early stage of NSCLC and could also be useful prognostic indicator for NSCLC
23360788 A high-concentration BMP2 decreases human periosteal cell proliferation and induces apoptosis via the activation of Wnt inhibitors DKK1 and SOST.
23359112 DKK-1 is an independent predictor of long-term MACE of patients with ACS. The long-term predictive ability of post-discharge GRACE score may be enhanced by adding DKK-1 level
23348703 demonstrated that miR-30a-5p counteracts the repressing effect of PRDM1 on the activity of Wnt/beta-catenin signalling and on the expression of Dkk1 as well
23316316 These in vivo data support the involvement of Wnt signaling in the development of aortic stenosis and suggest that circulating Wnt modulators such as DKK1 should be further investigated as risk markers in larger aortic stenosis populations.
23281130 HIV-1 gp120 upregulates the expression of dickkopf-1 in primary human osteoblasts
23266194 DKK1 was predominantly elevated in hepatocellular carcinoma tissues, especially in tissue with vascular invasion. DKK1 could promote hepatocellular carcinoma cell invasion and metastasis in vitro and in vivo.
23261982 Dkk-1 inhibited the survival and migration of human PTC cells by regulating Wnt/beta-catenin signaling and E-cadherin expression.
23152495 Matrix rigidity activates Wnt signaling through down-regulation of Dickkopf-1 protein
23125289 Plasma DKK1 levels were inversely associated with coronary artery and aortoiliac calcified plaques, but not vBMD, in this cross-sectional study of african americans with type 2 diabetes.
23041840 Patients with rheumatoid arthritis carrying risk alleles of genetic variants in Dkk-1 have higher serum levels of functional Dkk-1 and more progressive joint destruction over time.
23028464 The capacity of R. conorii to down-regulate endothelial-derived DKK-1 and the ability of silencing DKK-1 to attenuate R. conorii-induced inflammation in endothelial cells.
22984994 The study data demonstrate an association between SNP rs11001553 of the DKK1 gene and non-syndromic hypodontia in Chinese Han individuals.
22966878 Dietary vitamin D intake was strongly negatively associated with DKK1 methylation in a Newfoundland and Ontario colorectal cancer population.
22898215 Adalimumab significantly reduces inflammation and serum DKK-1 level but increases fatty deposition in lumbar spine in active ankylosing spondylitis.
22815877 genistein treatment decreases cell growth and proliferation in colon cancer cell lines, with increased DKK1 expression through the induction of histone acetylation at the DKK1 promoter region
22796372 The serum DKK1 concentrations were significantly higher in the gastric cancer patients than in the healthy controls
22789636 DKK1 putatively associates with primary osteoporosis.
22738799 DKK1 could complement measurement of AFP in the diagnosis of hepatocellular carcinoma and improve identification of patients with AFP-negative HCC and distinguish HCC from non-malignant chronic liver diseases.
22723594 Overview of DKK1 function and its potential as a target in bone disease treatment. [Review Article]
22649545 DKK1 together with beta-catenin might be important prognostic factors in triple negative breast carcinoma.
22592030 Serum levels of Dickkopf-1 are significantly lower six months after aortic valve replacement.
22589387 Crystal structures of the LRP6 ectodomain in complex with DKK1, along with mutagenesis studies, provide considerable insights into the molecular basis for DKK-mediated inhibition and Wnt signaling through LRP5/6
22576962 our study identified Gremlin 1, FRP, and Dkk-1 as natural brakes on hypertrophic differentiation in articular cartilage.
22527202 A negative association was seen between DKK1 and SI
22496615 Dickkopf-1 expression levels were significantly upregulated in gastric cancer lesions compared with adjacent noncancerous tissues, and level correlated with depth of invasion, vessel invasion, lymph node and distant metastasis, and TNM stage of tumors.
22455953 DKK1 is a feedback regulator of beta-catenin levels.
22447857 Human adipose cells can promote adipogenesis via endogenous BMP4 activation, and the impaired adipogenesis in hypertrophic obesity is mainly due to an inability to suppress canonical WNT and to induce DKK1.
22430125 these findings identify DKK-1 as a potential factor in the regulation of CA9 cellular homeostasis and also suggest a new possible role for DKK1-1 in tumorigenesis
22399772 Expression of the Wnt antagonist Dkk1 is increased in brains of Alzheimer's disease (AD) patients and in AD transgenic mouse models, suggesting that dysfunction of Wnt signaling could contribute to AD pathology.
22391424 This study establishes an association between low Wnt-1 and high Dkk-1 serum levels and premature myocardial infarction
22386696 DKK1 secreted by fibroblasts could play a role in the development or maintenance of vitiligo by directly/indirectly affecting the survival of keratinocytes or melanocytes
22363428 These data identify aberrant methylation of the DKK1 promoter as a cause of DKK1 silencing in advanced stage multiple myeloma.
22358062 DKK-1 is involved in anagen-to-catagen transition in the hair cycle by regulating the activity of follicular keratinocytes.
22321022 Our findings indicate that Dkk1 can suppress the progression of colon cancer, possibly through EMT inhibition.
22278426 Data suggest that, in contrast to other skeletal disorders, serum Dkk1 levels are not elevated above control subjects in adults with Langerhans cell histiocytosis; serum OPG levels are high and serum RANKL levels are low compared to control subjects.
22122879 Psychosis led to elevated serum DKK1 levels, and substance abuse led to a further increase.
22120987 Alteration of Dickkopf-1 and receptor activator of nuclear factor-kappaB ligand during PBSC mobilization in healthy donors by G-CSF.
22048647 Dexamethasone reduces proliferation and interferes with differentiation of neural progenitor cells via DKK1 and the canonical Wnt-signaling pathway.
22042700 Data show that serum levels of the Dickkopf-related protein 1 (DKK1) and osteoclast-activating factor MIP-1alpha were significantly elevated in patients with monoclonal gammopathy of undetermined significance (MGUS).
22032557 Alterations of both Wnt inhibitors (DKK-1 and sclerosin) were comparable in rheumatoid arthritis patients treated with tocilizumab.
22022386 VDR single nucleotide polymorphisms and DKK1 methylation were not associated with colon polyp.
22015605 SOX2 might have a specific function by regulating DKK1 and c-MYC in the differentiation and growth of ASCs, which is separate from its roles in ESCs.
22000856 The Dkk1 N-terminal domain binds to LRP6(1-2), demonstrating that a single Dkk1 molecule can bind to both portions of the LRP6 ectodomain and thereby inhibit different Wnts.
21984209 Results provide key insights for understanding LRP5/6 structure and the interaction of LRP5/6 with DKK1, as well as for drug discovery.
21955977 Both DKK1 transcript and serum protein were upregulated in a stepwise manner in human hepatocellular carcinomas.
21944579 The LRP5/6 binding motif is required for DKK1 and SOST function.
21944272 Fetal DDK-1 concentrations are lower in the Intrauterine growth restriction group, representing probably a compensatory mechanism, favoring the formation of mineralized bone
21935273 Serum DKK1 concentrations correlate with the coronary atherosclerosis and play an independent role in predicting the presence of coronary atherosclerosis
21909757 Exogenous expression of DKK1 in EC9706 cell line resulted in an increased rate of proliferation, and S stage and G2/M stage ratio whereas G0/G1 ratio was decreased.
21858178 Data show that decidualization was associated with increased expression of 428 genes including SCARA5 (181-fold), DKK1 (71-fold) and PROK1 (32-fold), and decreased expression of 230 genes including MMP-7 (35-fold) and SFRP4 (21-fold).
21833531 Suggest low serum DKK-1 level is related to the pathogenesis of new bone formation in ankylosing spondylitis, which is resistant to TNF-alpha blocking therapy.
21811562 GATA6 promotes pancreatic carcinogenesis by virtue of its activation of canonical Wnt signaling via regulation of DKK1.
21805521 study reports the characterization of glycosylation, including the sites of glycosylation and proposed glycan structures, as well as the determination of overall disulfide structure of the two Cys-rich domains of DKK1
21712726 dickkopf-1 has a role in rectal cancer and may be a tumor marker
21683813 DKK1 is a novel target gene in the response to amino acid deficiency and that the expression of DKK1 is up-regulated through an ATF4-independent and an ERK-dependent pathway.
21663914 Dickkopf-1 may have a role in acute ischemic stroke and clinically stable cerebrovascular disease
21617850 Dkk1 plays an important role in regulating cellular migration and invasiveness.
21607803 Quantitative real-time RT-PCR and Western blot analysis showed that the expression of DKK1 mRNA and protein in 32 ovarian serous papillary adenocarcinoma (OSC) tissues were elevated as compared with those in 10 normal ovarian tissues
21562161 inhibition of beta-catenin signaling was dependent on its ability to induce DKK1, in a STAT 3-dependent manner. Inhibition of STAT3 and DKK1 abrogated the ability of IFN-gamma to enhance HIV replication in astrocytes.
21546446 identified a novel signalling pathway whereby PROK1 can induce the expression of DKK1 in the human endometrium and first trimester decidua
21540552 there are distinct functions of DKK1 and DKK2 in controlling angiogenesis
21531794 Modulation of DKK1 bioactivity by a monoclonal antibody in the adult osteopenic skeleton is a viable approach to treatment of osteopenia in animal models.
21389688 this data suggest that increased Dkk-1 expression is an early event in melanoma, decreasing in later tumor stages.
21362762 DKK-1, as an important mediator, was correlated with bone erosion and inflammation in RA.
21344486 Several members of the WNT pathway, including WNT5A, FZD5, and DKK1 were highly up-regulated in PCa tissue from patients with advanced PCa.
21317455 Novel insights into roles for DKK1 in addition to canonical WNT signaling and the mechanism of colon cancer initiating cells transformation.
21304055 Promoter methylation of Wnt antagonists DKK1 and SFRP1 is associated with opposing tumor subtypes in two large populations of colorectal cancer.
21164019 Serum levels of Dkk-1 did not correlate with intact parathyroid hormone or with any histomorphometric parameter
21098705 Data show that DKK-1 knockdown PCa cells exhibited increased expression of the CDK inhibitor p21(CIP1/WAF1) and a 32% increase in G(1) arrest compared with control cells.
21062498 Dkk-1 serves as a biochemical marker for determining osteoarthritis (OA) severity and might play a potential role in the pathogenesis of the degenerative process of OA.
21034532 L-threonate inhibited DKK-1 expression in dermal papilla cells and therefore is a good treatment for the prevention of androgen-driven balding.
21029453 The Wnt antagonist DKK-1 gene may have important roles in glioma tumorigenesis and act as a novel biomarker in human malignant glioblastoma.
20957670 DKK-1 is a potenet inhibitor of bone growth in prostate cancer-induced osteoblastic metastases.
20932948 DKK1 was inversely related to adiponectin in obese children.
20929859 Generation and selection of novel fully human monoclonal antibodies that neutralize Dickkopf-1 (DKK1) inhibitory function in vitro and increase bone mass in vivo.
20920327 Results indicate that DKK-1 has a pro-apoptotic function in gliomas.
20847303 DKK1 enhances angiogenic properties of endothelial stem cellss (ECFC) in vitro and is required for ECFC and mesenchymal stem cell angiogenic phenotypes in vivo. DKK1 also increases tumoral angiogenesis.
20843343 Silencing Dkk1 expression rescues dexamethasone-induced suppression of primary human osteoblast differentiation.
20823417 integrative genomics approach to a large cohort of medulloblastomas has identified four disparate subgroups(DKK1)with distinct demographics, clinical presentation, transcriptional profiles, genetic abnormalities, and clinical outcome.
20819596 There was a cross-talk between DKK-1 and OPG, which involved in bone destruction in RA. In different stage of RA, DKK-1 and OPG may play different roles in the pathogenesis of RA.
20797317 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20653953 These data indicate that HBZ of human T-cell leukemia virus type 1 activates Dkk1 expression through its interaction with p300/CBP.
20650998 DKK1 and DKK4 proteins are expressed in the lung epithelium in idiopathic pulmonary fibrosis
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20618428 the expression of DKK1 in chronic lymphocytic leukemia cells; DKK1 does not inactivate WNT pathway.
20613589 DKK-1 expression was downregulated during early and late osteogenesis in both qRT and microarray analyses.
20603237 DKK1 blood levels seem to have a predictive value with regard to the severity and the prognosis of bone neoplasms in a subset of patients with metastatic tumor.
20589421 elevated serum levels are associated with bone erosion in patients with systemic lupus erythematosus
20549706 Loss of DKK1 is associated with renal cell carcinoma.
20543981 results reveal a novel role for Dkk1 in preventing Wnt ligand-induced LRP6 down-regulation and contribute significantly to our understanding of Dkk1 function in Wnt/LRP6 signaling
20153141 Observational study of gene-disease association. (HuGE Navigator)
20139903 Overexpression of DKK-1 was able to accelerate phosphorylation-dependent degradation of beta-catenin and downregulate the expression of beta-catenin, c-Myc, cyclin D1 and Survivin
20101398 A common SNP in DKK1 does have a significant effect on hip axis length, implying a possible effect on hip fracture risk in the general population.
20101398 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20093360 analysis of the frizzled8.Wnt3a.LRP6 signaling complex reveals multiple Wnt and Dkk1 binding sites on LRP6
20039407 Dkk-1 is dysfunctional in ankylosing spondylitis.
20038269 Studies indicate that DKK1 is involved in MM-induced suppression of osteoblastogenesis and subsequent stimulation of osteoclastogenesis.
20033851 overexpressed in skin fibroblast cells derived from leprechaunism patients
20019092 EWS/FLI1 inhibits both DKK-1 expression as well as beta-catenin/TCF-dependent transcription, which could contribute to progression of tumours of the Ewing family.
20004015 Data indicate major roles for Dkk1 and the canonical Wnt pathway in early-stage differentiation, and for Dkk2 and Wnt/Ca2+-dependent signaling in late-stage differentiation on microstructured and hydrophilic surfaces, during osseointegration.
19995224 Frequent allelic loss of Dkk-1 locus (10q11.2) is related with low distant metastasis and better prognosis in head and neck squamous cell carcinomas.
19955106 Aberrant expression of DKK1 might impair embryo attachment and implantation in vivo.
19943155 Thiazolidinediones increase the wingless-type MMTV integration site family (WNT) inhibitor Dickkopf-1 in adipocytes
19936252 Lrp4 is a novel osteoblast expressed Dkk1 and sclerostin receptor with a physiological role in the regulation of bone growth and turnover
19926868 Observational study of gene-disease association. (HuGE Navigator)
19898734 Analysis of association of DKK1, genes with bone mineral density in a Slovenian population
19898734 Observational study of gene-disease association. (HuGE Navigator)
19895917 DKK1 is an apoptosis-promoting factor that accelerates bone microstructure deterioration in the osteonecrosis of femoral heads.
19832854 Dkk-1 levels are increased in women with postmenopausal osteoporosis.
19820386 Dickkopf-1 protein detection using enzyme-linked immunosorbent assay as a molecular marker can contribute to the detection and the diagnosis of cervical and endometrial cancers, especially for cervical squamous cell cancer.
19787627 DKK1 expression may be a useful prognostic and diagnostic indicator for epithelial ovarian carcinoma.
19776352 Data demonstrate a novel role of Dkk-1 in the regulation of directional polarization of migrating intestinal epithelial cells, which contributes to the effect of Dkk-1 on wound closure in vivo.
19746449 a high bone mass mutant LRP5(G171V), has subtly reduced Dkk1 binding, and, in contrast to LRP5, no enhancement of binding with MesD
19744316 Expression of DKK1 and TPH1 were negatively regulated by ASCL1 in pancreatic endocrine tumours.
19720407 In patients with acute coronary syndrome, reduction in DKK1 levels by atorvastatin may increase the number and activity of osteoblasts and thereby stimulate bone formation.
19711349 DKK-1 expression was consistently and significantly upregulated in pancreatic carcinoma.
19675559 palmoplantar skin is thicker and paler than non-palmoplantar skin through the secretion of DKK1 by fibroblasts that affect the overlying epidermis
19657367 Single nucleotide polymorphism in DKK1 gene is associated with bone disease in myeloma.
19540374 The development of fracture non union is linked with a localised reduced capacity of cells to undergo osteogenesis, which in turn is associated with increased cell senescence and Dkk-1 secretion.
19477926 Results identify the first propeller domain as a novel regulatory domain for DKK1 binding to LRP6.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19424619 DKK1 is involved in genesis and early phase of endometrial carcinoma by suppressing the invasiveness via the Wnt signal pathway. It shows promise as a biomarker for screening disease progression.
19407319 Results suggest that Dickkopf-1 is implicated in the pathogenesis of osteoporosis in thalassemia and reveal Dickkopf-1 as a possible target for the development of novel agents for the management of thalassemia-induced osteoporosis.
19396460 Loss of CD44 and gain of DKK1 expression characterizes progression from Barrett esophagus to dysplasia and adenocarcinoma.
19389391 Dkk-1 and total serum alkaline phosphatase activity (tsAP) were significantly elevated in sera from Paget's disease of bone patients.
19358268 data suggest that overexpression of Nmi inhibits the Wnt/beta-catenin signaling via up-regulation of Dkk1 and retards tumor growth.
19303159 DKK1, alone or combined with beta-catenin, is a novel prognostic predictor for hepatocellular carcinoma patients.
19273195 data suggest that Dkk-1 stimulates the release of beta-catenin from cell membrane and facilitates cell migration which accompanies degradation of beta-catenin/E-cadherin
19252761 In conclusion, serum Dkk-1 is stable with age in healthy women and men and increases in patients with BC and BM. Measurements of circulating Dkk-1 with this new ELISA may be useful for the clinical investigation of patients with malignant bone diseases.
19247449 Given the mutually exclusive expression of DKK1 and DKK2, EWS/ETS regulates the transcription of the DKK family, and the EWS/ETS-mediated DKK2 up-regulation could affect the tumorigenicity of EFT in an indirect manner
19093005 Dkk1 may play an important role in downregulating self-renewal and proliferation pathway of stem cells at the late stage of differentiation, and its failure may lead to carcinogenesis.
19067746 myeloma cells are the main source of circulating DKK-1 protein and provide a framework for clinical trials on anti-DKK-1 treatment in multiple myeloma
19040566 Dkk1 and sFRP4 perform an important function in adipogenesis in human adipose tissue-derived mesenchymal stem cells.
19016584 Inhibiting Dkk1 prevents the suppression of bone formation and in doing so is effective in preventing the development of osteolytic bone disease in myeloma.
18978943 Serum DKK-1 levels are increased in prostate cancer patients.
18843784 Increased Dickkopf-1 blood levels were associated with a higher risk of progression of bone erosion, independently of age, sex, baseline radiological damage, C-reactive protein, and disease activity in Rheumatoid Arthritis patients.
18653765 FHL2-beta-catenin interaction potentiates beta-catenin nuclear translocation and TCF/LEF transcription, resulting in increased Runx2 and alkaline phosphatase expression, which was inhibited by the Wnt inhibitor DKK1.
18606139 DKK1 regulates distinct internalization pathways of LRP6 to tune the activation of beta catenin signaling.
18571836 Dkk-1 secreted by mesenchymal stem cells inhibits growth of breast cancer cells via depression of Wnt signalling.
18561248 Elevated DKK-1 expression is an early event in prostate cancer (PCa) and that as PCa progresses DKK-1 expression declines, particularly in advanced bone metastases.
18546262 Breast cancer-produced Dkk1 may be an important mechanistic link between primary breast tumors and secondary osteolytic bone metastases.
18521528 DKK1 and sclerostin are independent, and not synergistic, regulators of LRP5 signaling and that the function of each is impaired by HBM-LRP5 mutations
18505732 DKK1 inhibition of LRP6 is independent of LRP6 internalization and degradation
18502762 Kremen may not be essential for Dkk1-mediated Wnt antagonism and Kremen may only play a role when cells express a high level of LRP5/6
18461655 Down-regulation of the Dkks associated to promoter hypermethylation appears to be frequently involved in gastrointestinal tumorigenesis.
18339843 ASH1 inactivates DKK1 and DKK3, negative regulators of Wnt/beta-catenin signaling, E-cadherin, and integrin beta1 through ASH1-mediated deacetylation and repressive trimethylation of lysine 27 of histone H3 in the promoter regions of DKK1 and E-cadherin.
18331598 Using a large series of myeloma patients, we could show for the first time a correlation between DKK-1 serum concentration and the amount of lytic bone disease, indicating that DKK-1 is an important factor for the extent of bone disease
18305214 DKK1 may play a key role in the development of osteolytic bone lesions in multiple myeloma by directly interrupting Wnt3a-regulated differentiation of osteoblasts
18297060 MesP1 drives vertebrate cardiovascular differentiation through Dkk-1-mediated blockade of Wnt-signalling
18294945 Dkk1 inhibits this process and may be a key factor regulating pre-osteoblast differentiation and myeloma bone disease
18163421 Significant association with late-onset Alzheimer's disease for 4 SNPs: rs1881747 near DKK1, rs2279420 in ANK3, rs2306402 in CTNNA3, and rs5030882 in CXXC6 in 1,160 cases and 1,389 controls.
18163421 Observational study of gene-disease association. (HuGE Navigator)
18157634 DKK-1 mediated tumor suppressor effect is independent of beta-catenin dependent transcription and a CamKII pathway contributes to DKK-1 signaling
17987039 Data demonstrate that systemic levels of Dkk-1 are elevated in osteosarcoma (OS) and may serve as a prognostic or diagnostic marker for evaluation of OS.
17984176 findings further elucidate why human skin is thicker and paler on the palms and soles than on the trunk through topographical and site-specific differences in the secretion of DKK1 by dermal fibroblasts that affects the overlying epidermis.
17876334 Increased Dickkopf-1 expression is associated with breast cancer bone metastases
17702698 In 60 multiple myeloma patients checked, it was found that among the Wnt inhibitors, Dickkopf-1 and secreted frizzled-related protein-3 were produced by multiple myeloma cells.
17700537 concludes that bone-derived prostate cell line that produces osteoblastic lesions induces new bone formation through Wnt canonical signaling, that LRP5 mediates this effect, and that DKK1 is involved in the balance between bone formation and resorption
17657240 data strongly suggests that dihydrotestosterone-inducible DKK-1 is involved in dihydrotestosterone-driven balding
17643814 MYCN might stimulate cell proliferation by inhibiting the expression of DKK1. DKK1 might exert part of its growth suppressive effect by induction of SYNPO2 expression.
17485441 DKK1 and SFRP1 inhibit the transformed phenotype of breast cancer cell lines, and DKK1 inhibits tumor formation.
17449905 Calcitriol activates the transcription of the DKK-1 gene, probably in an indirect way that is associated to the promotion of a differentiated phenotype in colon cancer cells.
17373700 Observational study of gene-disease association. (HuGE Navigator)
17329407 Inappropriate histone modifications might deregulate DKK1 expression in medulloblastoma tumorigenesis and block its tumor-suppressive activity.
17255354 Oxidative stress response regulates DKK1 expression through the JNK signaling cascade in multiple myeloma plasma cells.
17245340 DKK1 as a potential prognostic and diagnostic marker for cohorts of breast cancer patients with poor prognosis. Dickkopf-1 may also become a relevant candidate target for immunotherapy of different cancers.
17237793 Dickkopf-1 is a master regulator of joint remodeling.
17159916 These results further clarify the mechanism by which DKK1 suppresses melanocyte density and differentiation, and help explain why DKK1-rich palmoplantar epidermis is paler than non-palmoplantar epidermis via mesenchymal-epithelial interactions.
17068150 DKK1 is a key player in multiple myeloma bone disease
17026960 Together, our data indicate the possible correlation between Dkk-1 and human placental choriocarcinoma and suggest potential applications of Dkk-1 in treatment of human placental choriocarcinomas.
16919965 The demonstration that DKK1 inhibits Wnt signaling in neurons and causes neuronal death supports the hypothesis that inhibition of the canonical Wnt pathway contributes to the pathophysiology of neurodegenerative disorders.
16863544 Dkk-1 and Dkk-4 may potentially be involved in the development of different injuries in response to pathological gastroesophageal acid reflux.Dickkopf homologs in squamous mucosa of esophagitis patients are overexpressed in Barrett's esophagus.
16763196 The involvement of Dkk1 in human but not murine adipogenesis indicates that inter-species differences exist in the molecular control of this process.
16646053 reduction of DKK-1 levels after autologous stem cell transplantation may correlate with the normalization of osteoblast function
16568085 loss of DKK expression plays a role in development or progression of malignant melanoma
16491118 DKK-1 promoter was selectively hypermethylated in advanced colorectal neoplasms
16293576 Marrow stromal cell-conditioned medium promotes the proliferation of Dickkopf-1-secreting multiple myeloma cells.
15923613 These data suggest that HBM mutant proteins can transit to the cell surface in sufficient quantity to transduce Wnt signal and that the likely mechanism for the HBM mutations' physiologic effects is via reduced affinity to and inhibition by DKK1.
15694380 We found that Dkk1-Fz5, but not Dkk3-Fz5, potently synergized with LRP6 to activate signaling in a dishevelled-dependent manner.
15592505 DKK-1 expression decreases in human colon tumors, suggesting that DKK-1 acts as a tumor suppressor gene in this neoplasia; the Wnt/beta-catenin pathway is downregulated by the induction of DKK-1 expression, a mechanism that is lost in colon cancer
15592430 Data show that FGF20 and DKK1 appear to be direct targets for beta-catenin/TCF transcriptional regulation via LEF/TCF-binding sites, and are expressed early in Xenopus embryogenesis under the control of the Wnt signaling pathway.
15451431 Together, our data suggest that Dkk-1 may be able to antagonize Wnt signaling and exert its tumor suppressive effects through beta-catenin-independent non-canonical pathways (i.e., the Wnt/JNK pathway).
15229249 Induction of DKK1 contributes to the pathological cascade triggered by beta-amyloid and is critically involved in the process of tau phosphorylation.
15117970 Data show that DKK1 decreass melanocyte function, probably through beta-catenin-mediated regulation of microphthalmia-associated transcription factor activity, which in turn modulates the growth and differentiation of melanocytes.
14695408 Recombinant DKK1 inhibits the differentiation of osteoblastic precursor cells
12740383 dickkopf-1 has a critical role in reentry into the cell cycle of human adult stem cells from bone marrow
12167704 Analysis of individual Dkk domains & chimeric Dkks shows that the carboxy-terminal domains of both Dkk1 & 2 associate with LRP6 & are necessary & sufficient for Wnt8 inhibition. The NH2-terminal of Dkk1 plays an inhibitory role in Dkk-LRP interactions.
11840333 overexpression sensitizes brain tumor cells to apoptosis after DNA alkylation damage; may link WNT and p53 pathways

AA Sequence

MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPG      1 - 70
GNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVS     71 - 140
SDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKIC    141 - 210
KPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH                  211 - 266
//

Text Mined References (314)

PMID Year Title
27015306 2016 Metastatic Latency and Immune Evasion through Autocrine Inhibition of WNT.
26986465 2016 Diagnostic Performance of Alpha-Fetoprotein, Protein Induced by Vitamin K Absence, Osteopontin, Dickkopf-1 and Its Combinations for Hepatocellular Carcinoma.
26927559 2016 [RANKL increases on peripheral blood T lymphocytes and serum Dickkopf1 decreases in rheumatoid arthritis].
26782930 2016 DKK1 expression by synovial fibroblasts in very early rheumatoid arthritis associates with lymphocyte adhesion in an in vitro flow co-culture system.
26782539 2015 Downregulation of serum DKK-1 predicts poor prognosis in patients with papillary thyroid cancer.
26782465 2015 Serum Dickkopf-1 levels as a clinical and prognostic factor in patients with bladder cancer.
26780085 2016 The analysis of DKK1 polymorphisms in relation to skeletal phenotypes and bone response to alendronate treatment in Chinese postmenopausal women.
26545120 2015 SOST Inhibits Prostate Cancer Invasion.
26407843 2015 P38 regulates the Wnt inhibitor Dickkopf-1 in breast cancer.
26400224 2015 Downregulation of MicroRNA-152 contributes to high expression of DKK1 in multiple myeloma.
26378045 2015 NBAT1 suppresses breast cancer metastasis by regulating DKK1 via PRC2.
26353782 2015 DKK1 is a potential novel mediator of cisplatin-refractoriness in non-small cell lung cancer cell lines.
26297437 2015 Wnt/?-Catenin Signaling Activation beyond Robust Nuclear ?-Catenin Accumulation in Nondysplastic Barrett's Esophagus: Regulation via Dickkopf-1.
26256972 2015 Serum Dickkopf-1 as a Biomarker for the Diagnosis of Hepatocellular Carcinoma.
26239269 2015 Dickkopf?related protein 1 induces angiogenesis by upregulating vascular endothelial growth factor in the synovial fibroblasts of patients with temporomandibular joint disorders.
26125834 2015 DKK1 eukaryotic expression plasmid and expression product identification.
26101916 2015 Serum dickkopf-1 is a novel serological biomarker for the diagnosis and prognosis of pancreatic cancer.
25974190 2015 Factors associated with serum soluble inhibitors of Wnt-?-catenin signaling (sclerostin and dickkopf-1) in patients undergoing peritoneal dialysis.
25941031 2015 Tumor necrosis factor and interleukin-6 differentially regulate Dkk-1 in the inflamed arthritic joint.
25901391 2015 Differential expression of Dickkopf-1 among non-small cell lung cancer cells.
25889943 2015 Serum Dickkopf-1 signaling and calcium deposition in aortic valve are significantly related to the presence of concomitant coronary atherosclerosis in patients with symptomatic calcified aortic stenosis.
25877354 2015 Association of serum Dkk-1 levels with ?-catenin in patients with postmenopausal osteoporosis.
25873352 2015 Dickkopf-1 induces apoptosis in the JEG3 and BeWo trophoblast tumor cell lines through the mitochondrial apoptosis pathway.
25837853 2015 Assessment of the Effect of Methotrexate Therapy on Bone Metabolism in Patients with Rheumatoid Arthritis.
25805736 2015 Genetic contribution of DKK-1 polymorphisms to RA structural severity and DKK-1 level of expression.
25788273 2015 Nuclear DICKKOPF-1 as a biomarker of chemoresistance and poor clinical outcome in colorectal cancer.
25694360 2015 Dickkopf-1 and sclerostin serum levels in patients with systemic mastocytosis.
25652109 2015 Diagnostic values of alpha-fetoprotein, dickkopf-1, and osteopontin for hepatocellular carcinoma.
25596857 2015 Sclerostin and DKK-1: two important regulators of bone metabolism in HIV-infected youths.
25550102 2015 Heritability and genetics of serum dickkopf 1 levels in African ancestry families.
25487617 2015 The negative regulators of Wnt pathway-DACH1, DKK1, and WIF1 are methylated in oral and oropharyngeal cancer and WIF1 methylation predicts shorter survival.
25484108 2015 Effect of recent spinal cord injury on wnt signaling antagonists (sclerostin and dkk-1) and their relationship with bone loss. A 12-month prospective study.
25438096 In patients with rheumatoid arthritis, Dickkopf-1 serum levels are correlated with parathyroid hormone, bone erosions and bone mineral density.
25436422 2015 Induction of DKK1 by ox-LDL negatively regulates intracellular lipid accumulation in macrophages.
25424899 2015 DACT1 is involved in human placenta development by promoting Wnt signaling.
25422182 2014 Assessing the diagnostic value of serum Dickkopf-related protein 1 levels in cancer detection: a case-control study and meta-analysis.
25369286 2014 Relationship of Dickkopf1 (DKK1) with cardiovascular disease and bone metabolism in Caucasian type 2 diabetes mellitus.
25351982 2015 CBX7 inhibits breast tumorigenicity through DKK-1-mediated suppression of the Wnt/?-catenin pathway.
25344678 2015 Preliminary mechanism on the methylation modification of Dkk-1 and Dkk-3 in hepatocellular carcinoma.
25319845 2015 Sequencing of the DKK1 gene in patients with anorectal malformations and hypospadias.
25291949 2014 Serum functional dickkopf-1 levels are inversely correlated with radiographic severity of ankylosing spondylitis.
25271869 2015 Decreased dickkopf-1 levels in chronic lymphocytic leukemia and increased osteopontin levels in non-Hodgkin's lymphoma at initial diagnosis: Could they be playing roles in pathogenesis?
25182503 2014 High serum levels of Dickkopf-1 are associated with a poor prognosis in prostate cancer patients.
25144498 2014 Elevated levels of Dickkopf-1 are associated with ?-catenin accumulation and poor prognosis in patients with chondrosarcoma.
25037197 2014 Circulating dickkopf-1 in diabetes mellitus: association with platelet activation and effects of improved metabolic control and low-dose aspirin.
24992617 2014 The role of preoperative serum levels for Dickkopf-related protein 1 as a potential marker of tumor invasion in patients with stage II and III colon cancer.
24947038 2014 Promoter hypermethylation of Wnt pathway inhibitors in hepatitis C virus - induced multistep hepatocarcinogenesis.
24926963 2014 Two single-nucleotide polymorphisms in the DKK1 gene are associated with developmental dysplasia of the hip in the Chinese Han female population.
24916146 2015 Dickkopf-1 expression is down-regulated during the colorectal adenoma-carcinoma sequence and correlates with reduced microvessel density and VEGF expression.
24878698 2014 Overexpression of Dickkopf-1 predicts poor prognosis for patients with hepatocellular carcinoma after orthotopic liver transplantation by promoting cancer metastasis and recurrence.
24848709 2014 Therapeutic potential of Dickkopf-1 in wild-type BRAF papillary thyroid cancer via regulation of ?-catenin/E-cadherin signaling.
24834937 2014 Dickkopf-1 is a novel prognostic biomarker for laryngeal squamous cell carcinoma.
24770633 2014 The expression of Wnt-inhibitor DKK1 (Dickkopf 1) is determined by intercellular crosstalk and hypoxia in human malignant gliomas.
24737523 2014 Association between rs11001553 of DKK1 and non-syndromic tooth agenesis in the Chinese Han population.
24736728 2014 Genetic analysis of high bone mass cases from the BARCOS cohort of Spanish postmenopausal women.
24733089 2014 Gene expression profiling identifies microphthalmia-associated transcription factor (MITF) and Dickkopf-1 (DKK1) as regulators of microenvironment-driven alterations in melanoma phenotype.
24676838 2014 Decreased expression of Dkk1 and Dkk3 in human clear cell renal cell carcinoma.
24671437 2014 Bidirectional effect of Wnt signaling antagonist DKK1 on the modulation of anthrax toxin uptake.
24612589 2014 Serum level of DKK-1 and its prognostic potential in non-small cell lung cancer.
24577091 2014 An unexpected role for a Wnt-inhibitor: Dickkopf-1 triggers a novel cancer survival mechanism through modulation of aldehyde-dehydrogenase-1 activity.
24481601 2014 Dickkopf-1, the Wnt antagonist, is induced by acidic pH and mediates epithelial cellular senescence in human reflux esophagitis.
24471564 2014 Role of sclerostin and dickkopf-1 in the dramatic alteration in bone mass acquisition in adolescents and young women with recent anorexia nervosa.
24469828 2014 The Fanconi anemia pathway has a dual function in Dickkopf-1 transcriptional repression.
24449494 2014 Dysfunction of Wnt signaling and synaptic disassembly in neurodegenerative diseases.
24444033 2015 Musashi1 regulates survival of hepatoma cell lines by activation of Wnt signalling pathway.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24430505 2014 Genetic determinants of heel bone properties: genome-wide association meta-analysis and replication in the GEFOS/GENOMOS consortium.
24391982 2013 Dickkopf-1 is oncogenic and involved in invasive growth in non small cell lung cancer.
24361889 2014 Lung cancer-derived Dickkopf1 is associated with bone metastasis and the mechanism involves the inhibition of osteoblast differentiation.
24325363 2013 DKK1 promotes hepatocellular carcinoma cell migration and invasion through ?-catenin/MMP7 signaling pathway.
24302746 2014 Serum Dickkopf 1 levels in sclerostin deficiency.
24286177 2013 GREM1, FRZB and DKK1 mRNA levels correlate with osteoarthritis and are regulated by osteoarthritis-associated factors.
24276456 2014 Severe abdominal aortic calcification in older men is negatively associated with DKK1 serum levels: the STRAMBO study.
24269823 2014 Disturbance of DKK1 level is partly involved in survival of lung cancer cells via regulation of ROMO1 and ?-radiation sensitivity.
24250816 2013 The role for dickkopf-homolog-1 in the pathogenesis of Crohn's disease-associated fistulae.
24227537 2014 The relationship between inhibitors of the Wnt signalling pathway (sclerostin and Dickkopf-1) and carotid intima-media thickness in postmenopausal women with type 2 diabetes mellitus.
24220876 2014 The association between serum Dickkopf-1 levels and esophageal squamous cell carcinoma.
24138842 2013 CER1 gene variations associated with bone mineral density, bone markers, and early menopause in postmenopausal women.
24134157 2014 HIV increases the release of dickkopf-1 protein from human astrocytes by a Cx43 hemichannel-dependent mechanism.
24104453 2014 Human umbilical cord mesenchymal stem cells inhibit C6 glioma growth via secretion of dickkopf-1 (DKK1).
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23922913 2013 Lysine-specific demethylase 1 (LSD1/KDM1A) contributes to colorectal tumorigenesis via activation of the Wnt/?-catenin pathway by down-regulating Dickkopf-1 (DKK1) [corrected].
23836157 2013 Genetic association study of Dickkopf-1 and sclerostin genes with paget disease of bone.
23752183 2014 Parathyroid hormone-related protein inhibits DKK1 expression through c-Jun-mediated inhibition of ?-catenin activation of the DKK1 promoter in prostate cancer.
23702386 2013 The relationship between inhibitors of the Wnt signalling pathway (Dickkopf-1(DKK1) and sclerostin), bone mineral density, vascular calcification and arterial stiffness in post-menopausal women.
23698475 2014 The Wnt antagonists DKK1 and SFRP1 are downregulated by promoter hypermethylation in systemic sclerosis.
23636253 2013 Dickkopf-1 (DKK1) phosphatase and tensin homolog on chromosome 10 (PTEN) crosstalk via microRNA interference in the diabetic heart.
23600832 2013 Increased Dickkopf-1 expression in patients with unexplained recurrent spontaneous miscarriage.
23595579 2013 DKK-1 in serum as a clinical and prognostic factor in patients with cervical cancer.
23546988 2014 Rheumatoid arthritis bone fragility is associated with upregulation of IL17 and DKK1 gene expression.
23467116 2013 Suppression of Sclerostin and Dickkopf-1 levels in patients with fluorine bone injury.
23457386 2013 RANKL/OPG ratio and DKK-1 expression in primary osteoblastic cultures from osteoarthritic and osteoporotic subjects.
23452984 2013 Differential expression of ?-catenin and Dickkopf-1 in the third trimester placentas from normal and preeclamptic pregnancies: a comparative study.
23445914 2013 Sclerostin and DKK1 levels during 14 and 21 days of bed rest in healthy young men.
23396252 2012 Promoter methylation of Wnt antagonist DKK1 gene and prognostic value in Korean patients with non-small cell lung cancers.
23360788 2013 High-concentration of BMP2 reduces cell proliferation and increases apoptosis via DKK1 and SOST in human primary periosteal cells.
23359112 2013 Dickkopf-1 as a novel predictor is associated with risk stratification by GRACE risk scores for predictive value in patients with acute coronary syndrome: a retrospective research.
23348703 2013 PRDM1 is directly targeted by miR-30a-5p and modulates the Wnt/?-catenin pathway in a Dkk1-dependent manner during glioma growth.
23316316 2012 Secreted Wnt modulators in symptomatic aortic stenosis.
23266194 2013 Dickkopf-1 (DKK1) promotes invasion and metastasis of hepatocellular carcinoma.
23261982 2013 Dickkopf-1 inhibits thyroid cancer cell survival and migration through regulation of ?-catenin/E-cadherin signaling.
23152495 2013 Matrix rigidity activates Wnt signaling through down-regulation of Dickkopf-1 protein.
23125289 2013 Plasma Dickkopf1 (DKK1) concentrations negatively associate with atherosclerotic calcified plaque in African-Americans with type 2 diabetes.
23041840 2013 Genetic studies on components of the Wnt signalling pathway and the severity of joint destruction in rheumatoid arthritis.
23028464 2012 A complex interaction between Rickettsia conorii and Dickkopf-1--potential role in immune evasion mechanisms in endothelial cells.
22988876 2012 The importance of Wnt signalling for neurodegeneration in Parkinson's disease.
22984994 2012 A case-control study of the association between tooth-development gene polymorphisms and non-syndromic hypodontia in the Chinese Han population.
22966878 2012 Vitamin D intake is negatively associated with promoter methylation of the Wnt antagonist gene DKK1 in a large group of colorectal cancer patients.
22902902 2012 Inhibition of the canonical Wnt pathway by Dickkopf-1 contributes to the neurodegeneration in 6-OHDA-lesioned rats.
22898215 2012 Adalimumab significantly reduces inflammation and serum DKK-1 level but increases fatty deposition in lumbar spine in active ankylosing spondylitis.
22815877 2012 Genistein affects histone modifications on Dickkopf-related protein 1 (DKK1) gene in SW480 human colon cancer cell line.
22796372 2012 Clinical significance of serum and tissue Dickkopf-1 levels in patients with gastric cancer.
22789636 2012 Rare variations in WNT3A and DKK1 may predispose carriers to primary osteoporosis.
22738799 2012 Serum DKK1 as a protein biomarker for the diagnosis of hepatocellular carcinoma: a large-scale, multicentre study.
22723594 2012 Sclerostin and Dickkopf-1 as therapeutic targets in bone diseases.
22649545 2012 Expression of dickkopf-1 and beta-catenin related to the prognosis of breast cancer patients with triple negative phenotype.
22615920 2012 LGR6 is a high affinity receptor of R-spondins and potentially functions as a tumor suppressor.
22592030 2012 Circulating osteoprotegerin and Dickkopf-1 changed significantly after surgical aortic valve replacement but remained without any significant differences after transcatheter aortic valve implantation.
22589387 2012 The structural basis of DKK-mediated inhibition of Wnt/LRP signaling.
22576962 2012 Gremlin 1, frizzled-related protein, and Dkk-1 are key regulators of human articular cartilage homeostasis.
22527202 2012 Circulating sclerostin and Dickkopf-1 (DKK1) in predialysis chronic kidney disease (CKD): relationship with bone density and arterial stiffness.
22496615 2012 Dickkopf-1 expression is a novel prognostic marker for gastric cancer.
22455953 2012 DNAJB6 governs a novel regulatory loop determining Wnt/?-catenin signalling activity.
22447857 2012 The WNT inhibitor Dickkopf 1 and bone morphogenetic protein 4 rescue adipogenesis in hypertrophic obesity in humans.
22430125 2012 Dickkopf-1 (DKK-1) interrupts FAK/PI3K/mTOR pathway by interaction of carbonic anhydrase IX (CA9) in tumorigenesis.
22399772 2012 The secreted Wnt antagonist Dickkopf-1 is required for amyloid ?-mediated synaptic loss.
22391424 2012 Premature myocardial infarction is associated with low serum levels of Wnt-1.
22386696 2012 DKK1 is highly expressed in the dermis of vitiligo lesion: is there association between DKK1 and vitiligo?
22363428 2012 Transcriptional silencing of the Wnt-antagonist DKK1 by promoter methylation is associated with enhanced Wnt signaling in advanced multiple myeloma.
22358062 2012 Dickkopf 1 promotes regression of hair follicles.
22321022 2012 Dickkopf-1 inhibits epithelial-mesenchymal transition of colon cancer cells and contributes to colon cancer suppression.
22278426 2012 Serum osteoprotegerin, RANKL, and Dkk-1 levels in adults with Langerhans cell histiocytosis.
22122879 2012 Increased serum Dickkopf-1 levels in drug-abusing psychotic patients.
22120987 2012 Alteration of Dickkopf-1 and receptor activator of nuclear factor-?B ligand during PBSC mobilization in healthy donors by G-CSF.
22048647 2012 Dickkopf 1 mediates glucocorticoid-induced changes in human neural progenitor cell proliferation and differentiation.
22042700 2011 Bone microstructural changes revealed by high-resolution peripheral quantitative computed tomography imaging and elevated DKK1 and MIP-1? levels in patients with MGUS.
22032557 Early effects of IL-6 receptor inhibition on bone homeostasis: a pilot study in women with rheumatoid arthritis.
22022386 2011 Case-control study of vitamin D, dickkopf homolog 1 (DKK1) gene methylation, VDR gene polymorphism and the risk of colon adenoma in African Americans.
22015605 2012 SOX2 has a crucial role in the lineage determination and proliferation of mesenchymal stem cells through Dickkopf-1 and c-MYC.
22000856 2011 Structural basis of Wnt signaling inhibition by Dickkopf binding to LRP5/6.
21984209 2011 Crystal structures of the extracellular domain of LRP6 and its complex with DKK1.
21955977 2011 Clinicopathological and prognostic significance of serum and tissue Dickkopf-1 levels in human hepatocellular carcinoma.
21944579 2011 Wnt antagonists bind through a short peptide to the first ?-propeller domain of LRP5/6.
21944272 2012 Intrauterine growth restriction may not suppress bone formation at term, as indicated by circulating concentrations of undercarboxylated osteocalcin and Dickkopf-1.
21935273 2011 A novel biomarker of coronary atherosclerosis: serum DKK1 concentration correlates with coronary artery calcification and atherosclerotic plaques.
21909757 2011 Dickkopf-1 is involved in invasive growth of esophageal cancer cells.
21858178 2011 Ectopic pregnancy as a model to identify endometrial genes and signaling pathways important in decidualization and regulated by local trophoblast.
21833531 2012 Dickkopf-1 level is lower in patients with ankylosing spondylitis than in healthy people and is not influenced by anti-tumor necrosis factor therapy.
21811562 2011 GATA6 activates Wnt signaling in pancreatic cancer by negatively regulating the Wnt antagonist Dickkopf-1.
21805521 2011 Human Dickkopf-1 (huDKK1) protein: characterization of glycosylation and determination of disulfide linkages in the two cysteine-rich domains.
21712726 2011 Relationship between clinicopathologic variables and serum and tissue levels of dickkopf-1 in patients with rectal cancer.
21683813 2011 Dickkopf homolog 1, a Wnt signaling antagonist, is transcriptionally up-regulated via an ATF4-independent and MAPK/ERK-dependent pathway following amino acid deprivation.
21663914 2011 Circulating Dickkopf-1 in acute ischemic stroke and clinically stable cerebrovascular disease.
21617850 2011 Dickkopf-1 in human oral cancer.
21607803 2011 Dickkopf-1 is frequently overexpressed in ovarian serous carcinoma and involved in tumor invasion.
21562161 2011 IFN-gamma mediates enhancement of HIV replication in astrocytes by inducing an antagonist of the beta-catenin pathway (DKK1) in a STAT 3-dependent manner.
21546446 2011 Prokineticin 1 induces Dickkopf 1 expression and regulates cell proliferation and decidualization in the human endometrium.
21540552 2011 The WNT antagonist Dickkopf2 promotes angiogenesis in rodent and human endothelial cells.
21531794 2011 A rate-limiting role for Dickkopf-1 in bone formation and the remediation of bone loss in mouse and primate models of postmenopausal osteoporosis by an experimental therapeutic antibody.
21389688 2011 Serum levels of glycoprotein Dickkopf-1 in patients with cutaneous malignant melanoma: a prospective pilot study.
21362762 2011 Circulating Dickkopf-1 is correlated with bone erosion and inflammation in rheumatoid arthritis.
21344486 2011 Expression profile of WNT molecules in prostate cancer and its regulation by aminobisphosphonates.
21317455 2010 The class I HDAC inhibitor MGCD0103 induces cell cycle arrest and apoptosis in colon cancer initiating cells by upregulating Dickkopf-1 and non-canonical Wnt signaling.
21304055 2011 Promoter methylation of Wnt antagonists DKK1 and SFRP1 is associated with opposing tumor subtypes in two large populations of colorectal cancer patients.
21164019 2011 Sclerostin and Dickkopf-1 in renal osteodystrophy.
21098705 2010 p21CIP-1/WAF-1 induction is required to inhibit prostate cancer growth elicited by deficient expression of the Wnt inhibitor Dickkopf-1.
21076409 2010 Common variants in 22 loci are associated with QRS duration and cardiac ventricular conduction.
21062498 2010 Dickkopf-1 (Dkk-1) in plasma and synovial fluid is inversely correlated with radiographic severity of knee osteoarthritis patients.
21034532 2010 Preventable effect of L-threonate, an ascorbate metabolite, on androgen-driven balding via repression of dihydrotestosterone-induced dickkopf-1 expression in human hair dermal papilla cells.
21029453 2010 Analysis of the expression profile of Dickkopf-1 gene in human glioma and the association with tumor malignancy.
20957670 2011 Dickkopf-1 (DKK-1) stimulated prostate cancer growth and metastasis and inhibited bone formation in osteoblastic bone metastases.
20932948 2011 Adipokines, bone-derived factors and bone turnover in obese children; evidence for altered fat-bone signalling resulting in reduced bone mass.
20929859 2010 Generation and selection of novel fully human monoclonal antibodies that neutralize Dickkopf-1 (DKK1) inhibitory function in vitro and increase bone mass in vivo.
20920327 2010 Elevated expression of Dickkopf-1 increases the sensitivity of human glioma cell line SHG44 to BCNU.
20847303 2010 The Wnt antagonist Dickkopf-1 increases endothelial progenitor cell angiogenic potential.
20843343 2010 Silencing Dkk1 expression rescues dexamethasone-induced suppression of primary human osteoblast differentiation.
20823417 2011 Medulloblastoma comprises four distinct molecular variants.
20819596 2010 Circulating Dickkopf-1 and osteoprotegerin in patients with early and longstanding rheumatoid arthritis.
20797317 2010 Analysis of copy number variation in 8,842 Korean individuals reveals 39 genes associated with hepatic biomarkers AST and ALT.
20723538 2010 Secreted Frizzled-related protein-2 (sFRP2) augments canonical Wnt3a-induced signaling.
20653953 2010 Expression of a protein involved in bone resorption, Dkk1, is activated by HTLV-1 bZIP factor through its activation domain.
20650998 2011 Dickkopf proteins influence lung epithelial cell proliferation in idiopathic pulmonary fibrosis.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20618428 2010 Evidence for non-functional Dickkopf-1 (DKK-1) signaling in chronic lymphocytic leukemia (CLL).
20613589 2010 Elucidating mechanisms of osteogenesis in human adipose-derived stromal cells via microarray analysis.
20603237 2011 Neuroblastoma and bone metastases: clinical significance and prognostic value of Dickkopf 1 plasma levels.
20589421 2010 Dickkopf-1 as potential biomarker to evaluate bone erosion in systemic lupus erythematosus.
20559569 2010 Endogenous Wnt/beta-catenin signaling is required for cardiac differentiation in human embryonic stem cells.
20549706 2011 Wnt antagonist DKK1 acts as a tumor suppressor gene that induces apoptosis and inhibits proliferation in human renal cell carcinoma.
20543981 2010 Dkk1 stabilizes Wnt co-receptor LRP6: implication for Wnt ligand-induced LRP6 down-regulation.
20153141 2010 Genetic association study of KREMEN1 and DKK1 and schizophrenia in a Japanese population.
20139903 2010 Downregulation of Dickkopf-1 is responsible for high proliferation of breast cancer cells via losing control of Wnt/beta-catenin signaling.
20101398 2010 Common genetic variation in the DKK1 gene is associated with hip axis length but not with bone mineral density and bone turnover markers in young adult men: results from the Odense Androgen Study.
20093360 2010 Reconstitution of a frizzled8.Wnt3a.LRP6 signaling complex reveals multiple Wnt and Dkk1 binding sites on LRP6.
20062063 2010 Several common variants modulate heart rate, PR interval and QRS duration.
20039407 2010 Evidence that Dkk-1 is dysfunctional in ankylosing spondylitis.
20039315 2010 Wnt3-frizzled 1 chimera as a model to study canonical Wnt signaling.
20038269 2010 Osteoblastogenesis and tumor growth in myeloma.
20033851 2010 Downregulation of Wnt-mediated ROS generation is causally implicated in leprechaunism.
20019092 2010 The EWS/FLI1 oncogenic protein inhibits expression of the Wnt inhibitor DICKKOPF-1 gene and antagonizes beta-catenin/TCF-mediated transcription.
20004015 2010 The roles of Wnt signaling modulators Dickkopf-1 (Dkk1) and Dickkopf-2 (Dkk2) and cell maturation state in osteogenesis on microstructured titanium surfaces.
19995224 2010 Frequent allelic loss of Dkk-1 locus (10q11.2) is related with low distant metastasis and better prognosis in head and neck squamous cell carcinomas.
19955106 2010 Excessive ovarian stimulation up-regulates the Wnt-signaling molecule DKK1 in human endometrium and may affect implantation: an in vitro co-culture study.
19943155 2010 Thiazolidinediones increase the wingless-type MMTV integration site family (WNT) inhibitor Dickkopf-1 in adipocytes: a link with osteogenesis.
19936252 2009 Lrp4, a novel receptor for Dickkopf 1 and sclerostin, is expressed by osteoblasts and regulates bone growth and turnover in vivo.
19926868 2010 A role for Wnt signaling genes in the pathogenesis of impaired lung function in asthma.
19898734 2009 Analysis of association of LRP5, LRP6, SOST, DKK1, and CTNNB1 genes with bone mineral density in a Slovenian population.
19895917 2010 Increased Dickkopf-1 expression accelerates bone cell apoptosis in femoral head osteonecrosis.
19832854 2010 The effect of teriparatide on serum Dickkopf-1 levels in postmenopausal women with established osteoporosis.
19820386 2009 Clinical significance of serum DKK-1 in patients with gynecological cancer.
19787627 The expression and significance of Dickkopf-1 in epithelial ovarian carcinoma.
19776352 2009 Dkk-1 inhibits intestinal epithelial cell migration by attenuating directional polarization of leading edge cells.
19746449 2009 A cell-based Dkk1 binding assay reveals roles for extracellular domains of LRP5 in Dkk1 interaction and highlights differences between wild-type and the high bone mass mutant LRP5(G171V).
19744316 2009 Identification of Achaete-scute complex-like 1 (ASCL1) target genes and evaluation of DKK1 and TPH1 expression in pancreatic endocrine tumours.
19720407 2010 Levels of DKK1 in patients with acute myocardial infarction and response to atorvastatin.
19711349 2010 Dickkopf-1 is overexpressed in human pancreatic ductal adenocarcinoma cells and is involved in invasive growth.
19675559 2009 Regulation of skin pigmentation and thickness by Dickkopf 1 (DKK1).
19657367 2009 Genetic polymorphisms of EPHX1, Gsk3beta, TNFSF8 and myeloma cell DKK-1 expression linked to bone disease in myeloma.
19540374 2009 Decreased osteogenesis, increased cell senescence and elevated Dickkopf-1 secretion in human fracture non union stromal cells.
19477926 2009 The first propeller domain of LRP6 regulates sensitivity to DKK1.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19424619 2009 Novel expression profiles and invasiveness-related biology function of DKK1 in endometrial carcinoma.
19407319 2009 Serum Dickkopf-1 is increased and correlates with reduced bone mineral density in patients with thalassemia-induced osteoporosis. Reduction post-zoledronic acid administration.
19396460 2009 Altered expression of CD44 and DKK1 in the progression of Barrett's esophagus to esophageal adenocarcinoma.
19389391 2009 Increased circulating Dickkopf-1 in Paget's disease of bone.
19358268 2009 Nmi (N-Myc interactor) inhibits Wnt/beta-catenin signaling and retards tumor growth.
19303159 2009 Elevated expression of DKK1 is associated with cytoplasmic/nuclear beta-catenin accumulation and poor prognosis in hepatocellular carcinomas.
19273195 2009 Dickkopf-1 enhances migration of HEK293 cell by beta-catenin/E-cadherin degradation.
19252761 2009 Assessment of circulating Dickkopf-1 with a new two-site immunoassay in healthy subjects and women with breast cancer and bone metastases.
19247449 2009 EWS/ETS regulates the expression of the Dickkopf family in Ewing family tumor cells.
19093005 2008 Olig2-induced neural stem cell differentiation involves downregulation of Wnt signaling and induction of Dickkopf-1 expression.
19067746 2009 Serum concentrations of DKK-1 decrease in patients with multiple myeloma responding to anti-myeloma treatment.
19060904 2009 An empirical framework for binary interactome mapping.
19040566 2008 The roles of Wnt antagonists Dkk1 and sFRP4 during adipogenesis of human adipose tissue-derived mesenchymal stem cells.
19016584 2009 Inhibiting Dickkopf-1 (Dkk1) removes suppression of bone formation and prevents the development of osteolytic bone disease in multiple myeloma.
18978943 2008 Osteoclasts are active in bone forming metastases of prostate cancer patients.
18843784 2008 Circulating dickkopf-1 and radiological progression in patients with early rheumatoid arthritis treated with etanercept.
18653765 2008 FHL2 mediates dexamethasone-induced mesenchymal cell differentiation into osteoblasts by activating Wnt/beta-catenin signaling-dependent Runx2 expression.
18606139 2008 Wnt3a and Dkk1 regulate distinct internalization pathways of LRP6 to tune the activation of beta-catenin signaling.
18571836 2008 Dkk-1 secreted by mesenchymal stem cells inhibits growth of breast cancer cells via depression of Wnt signalling.
18561248 2008 Dickkopf-1 expression increases early in prostate cancer development and decreases during progression from primary tumor to metastasis.
18546262 2008 Breast cancer-derived Dickkopf1 inhibits osteoblast differentiation and osteoprotegerin expression: implication for breast cancer osteolytic bone metastases.
18521528 2008 The binding between sclerostin and LRP5 is altered by DKK1 and by high-bone mass LRP5 mutations.
18505732 2008 DKK1 antagonizes Wnt signaling without promotion of LRP6 internalization and degradation.
18502762 2008 Characterization of the Kremen-binding site on Dkk1 and elucidation of the role of Kremen in Dkk-mediated Wnt antagonism.
18461655 2008 Transcriptional silencing of Dickkopf gene family by CpG island hypermethylation in human gastrointestinal cancer.
18339843 2008 Roles of achaete-scute homologue 1 in DKK1 and E-cadherin repression and neuroendocrine differentiation in lung cancer.
18331598 2008 Serum concentrations of DKK-1 correlate with the extent of bone disease in patients with multiple myeloma.
18305214 2008 Myeloma-derived Dickkopf-1 disrupts Wnt-regulated osteoprotegerin and RANKL production by osteoblasts: a potential mechanism underlying osteolytic bone lesions in multiple myeloma.
18297060 2008 MesP1 drives vertebrate cardiovascular differentiation through Dkk-1-mediated blockade of Wnt-signalling.
18294945 2008 Dkk1-induced inhibition of Wnt signaling in osteoblast differentiation is an underlying mechanism of bone loss in multiple myeloma.
18166153 2008 Differential effects of secreted frizzled-related proteins (sFRPs) on osteoblastic differentiation of mouse mesenchymal cells and apoptosis of osteoblasts.
18163421 2008 Association analysis of 528 intra-genic SNPs in a region of chromosome 10 linked to late onset Alzheimer's disease.
18157634 2008 Dickkopf-1 mediated tumor suppression in human breast carcinoma cells.
18044981 2007 An LRP5 receptor with internal deletion in hyperparathyroid tumors with implications for deregulated WNT/beta-catenin signaling.
17987039 2007 A potential role for Dkk-1 in the pathogenesis of osteosarcoma predicts novel diagnostic and treatment strategies.
17984176 2008 Dickkopf 1 (DKK1) regulates skin pigmentation and thickness by affecting Wnt/beta-catenin signaling in keratinocytes.
17876334 2007 Increased Dickkopf-1 expression in breast cancer bone metastases.
17804805 2007 R-Spondin1 regulates Wnt signaling by inhibiting internalization of LRP6.
17702698 2007 Production of Wnt inhibitors by myeloma cells: potential effects on canonical Wnt pathway in the bone microenvironment.
17700537 2008 Low-density lipoprotein receptor-related protein 5 (LRP5) mediates the prostate cancer-induced formation of new bone.
17657240 2008 Dihydrotestosterone-inducible dickkopf 1 from balding dermal papilla cells causes apoptosis in follicular keratinocytes.
17643814 2007 Dickkopf-1 is down-regulated by MYCN and inhibits neuroblastoma cell proliferation.
17485441 2007 c-Myc transforms human mammary epithelial cells through repression of the Wnt inhibitors DKK1 and SFRP1.
17449905 2007 The Wnt antagonist DICKKOPF-1 gene is induced by 1alpha,25-dihydroxyvitamin D3 associated to the differentiation of human colon cancer cells.
17373700 2007 Association studies of 23 positional/functional candidate genes on chromosome 10 in late-onset Alzheimer's disease.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17329407 2007 Dickkopf-1 is an epigenetically silenced candidate tumor suppressor gene in medulloblastoma.
17255354 2007 The oxidative stress response regulates DKK1 expression through the JNK signaling cascade in multiple myeloma plasma cells.
17245340 2007 The Wnt pathway regulator DKK1 is preferentially expressed in hormone-resistant breast tumours and in some common cancer types.
17237793 2007 Dickkopf-1 is a master regulator of joint remodeling.
17159916 2007 The effects of dickkopf 1 on gene expression and Wnt signaling by melanocytes: mechanisms underlying its suppression of melanocyte function and proliferation.
17143291 2006 Function and biological roles of the Dickkopf family of Wnt modulators.
17068150 2007 Antibody-based inhibition of DKK1 suppresses tumor-induced bone resorption and multiple myeloma growth in vivo.
17026960 2006 Dickkopf-1 induced apoptosis in human placental choriocarcinoma is independent of canonical Wnt signaling.
16919965 2006 Inhibition of Wnt signaling, modulation of Tau phosphorylation and induction of neuronal cell death by DKK1.
16863544 2006 Dickkopf homologs in squamous mucosa of esophagitis patients are overexpressed compared with Barrett's patients and healthy controls.
16763196 2006 The Wnt antagonist Dickkopf-1 and its receptors are coordinately regulated during early human adipogenesis.
16646053 2006 Serum concentrations of Dickkopf-1 protein are increased in patients with multiple myeloma and reduced after autologous stem cell transplantation.
16568085 2006 Expression of Dickkopf genes is strongly reduced in malignant melanoma.
16491118 2006 Epigenetic inactivation of the Wnt antagonist DICKKOPF-1 (DKK-1) gene in human colorectal cancer.
16293576 2006 A crosstalk between myeloma cells and marrow stromal cells stimulates production of DKK1 and interleukin-6: a potential role in the development of lytic bone disease and tumor progression in multiple myeloma.
16263759 2005 Mesd binds to mature LDL-receptor-related protein-6 and antagonizes ligand binding.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15923613 2005 Reduced affinity to and inhibition by DKK1 form a common mechanism by which high bone mass-associated missense mutations in LRP5 affect canonical Wnt signaling.
15694380 2005 Wnt-independent activation of beta-catenin mediated by a Dkk1-Fz5 fusion protein.
15592505 2005 The Wnt antagonist DICKKOPF-1 gene is a downstream target of beta-catenin/TCF and is downregulated in human colon cancer.
15592430 2005 FGF-20 and DKK1 are transcriptional targets of beta-catenin and FGF-20 is implicated in cancer and development.
15542433 2004 An autocrine mechanism for constitutive Wnt pathway activation in human cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15451431 2004 Dickkopf-1 antagonizes Wnt signaling independent of beta-catenin in human mesothelioma.
15378020 2004 DKK1, a negative regulator of Wnt signaling, is a target of the beta-catenin/TCF pathway.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15229249 2004 Induction of Dickkopf-1, a negative modulator of the Wnt pathway, is associated with neuronal degeneration in Alzheimer's brain.
15117970 2004 Mesenchymal-epithelial interactions in the skin: increased expression of dickkopf1 by palmoplantar fibroblasts inhibits melanocyte growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14695408 2003 The role of the Wnt-signaling antagonist DKK1 in the development of osteolytic lesions in multiple myeloma.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12857724 2003 Functional characterization of WNT7A signaling in PC12 cells: interaction with A FZD5 x LRP6 receptor complex and modulation by Dickkopf proteins.
12740383 2003 The Wnt signaling inhibitor dickkopf-1 is required for reentry into the cell cycle of human adult stem cells from bone marrow.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12167704 2002 Regulation of Wnt/LRP signaling by distinct domains of Dickkopf proteins.
12050670 2002 Kremen proteins are Dickkopf receptors that regulate Wnt/beta-catenin signalling.
11840333 2002 Human Dkk-1, a gene encoding a Wnt antagonist, responds to DNA damage and its overexpression sensitizes brain tumor cells to apoptosis following alkylation damage of DNA.
11742004 2002 Second cysteine-rich domain of Dickkopf-2 activates canonical Wnt signaling pathway via LRP-6 independently of dishevelled.
11516963 2001 Wnt signalling: antagonistic Dickkopfs.
11448771 2001 Head inducer Dickkopf-1 is a ligand for Wnt coreceptor LRP6.
11433302 2001 Novel mechanism of Wnt signalling inhibition mediated by Dickkopf-1 interaction with LRP6/Arrow.
11357136 2001 LDL-receptor-related protein 6 is a receptor for Dickkopf proteins.
10965128 2000 The genomic structure, chromosome location, and analysis of the human DKK1 head inducer gene as a candidate for holoprosencephaly.
10570958 1999 Functional and structural diversity of the human Dickkopf gene family.
10383463 1999 Isolation and biochemical characterization of the human Dkk-1 homologue, a novel inhibitor of mammalian Wnt signaling.