Property Summary

NCBI Gene PubMed Count 22
PubMed Score 20.00
PubTator Score 22.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -4.600 5.4e-08
osteosarcoma 2.440 7.6e-04
astrocytoma -1.400 4.7e-02
medulloblastoma, large-cell -1.200 2.1e-03
tuberculosis and treatment for 3 months -1.100 1.1e-03
non-small cell lung cancer -1.141 6.1e-11
colon cancer -1.700 4.9e-04
group 3 medulloblastoma -1.300 3.7e-02
subependymal giant cell astrocytoma -2.946 9.8e-03
spina bifida -1.613 3.8e-02
Breast cancer -1.200 2.6e-05
ductal carcinoma in situ -1.300 4.9e-04
invasive ductal carcinoma -2.100 2.9e-04
ovarian cancer -3.200 2.9e-17

Gene RIF (14)

PMID Text
25648220 DIXDC1 was overexpressed in gastric cancer and correlated with poor prognosis.
25042806 DIXDC1 depletion results in upregulation of Snail1 in a FAK-dependent manner, leading to increased cell invasion. MARK1 phosphorylation of DIXDC1 is required for its localization to focal adhesions and ability to suppress metastasis in mice.
23813858 DIXDC1 is associated with stage and prognosis in non-small cell lung cancer, and may promote invasion and migration through PI3K-AKT/AP-1-dependent activation of metalloproteinases
22832659 Transgenic DIXDC1 might contribute to pathophysiology underlying abnormal behaviors in schizophrenia and other major psychiatric disorders in mice.
21189423 a molecular mechanism for Ccd1-mediated Wnt activation in that Ccd1 converts latent polymeric Dvl to a biologically active oligomer(s).
20624590 This study reveal that Dixdc1 integrates DISC1 into Wnt-GSK3beta/beta-catenin-dependent and -independent signaling pathways during cortical development and further delineate how DISC1 contributes to neuropsychiatric disorders.
20085589 Wnt/beta-catenin pathway activation might upregulate DIXDC1 through a post-translational mechanism by inhibiting the ubiquitin-mediated degradation of the DIXDC1 protein.
19572978 over-expression of DIXDC1 might target p21 and cyclin D1 to promote colon cancer cell proliferation and tumorigenesis at least partially through activation of the PI3K/Akt pathway.
19375513 The GFP-tag fused DIXDC1 exogenously expressed co-localize with gamma-tubulin both at interphase and mitotic phase in the centrosomes.
18629627 DIXDC1 might play an important role during neurogenesis, overexpression of DIXDC1 in embryonic carcinoma P19 cells promoted neuronal differentiation, and inhibited gliogenesis induced by retinoic acid.
16814745 Thus, our data provide the first evidence that l-DIXDC1 may act as a novel branching component in the Wnt signaling pathway targeting both beta-catenin-TCF complex for gene expression and cytoskeleton for regulating dynamics of actin filaments.
15262978 Ccd1 inhibits Axin-mediated JNK activation by simultaneously adopting two distinct mechanisms, one through conformational changes that disallow MEKK1 binding and the other via direct sequestration of MEKK4.
12792787 KIAA1735 maps to human chromosome 11q23.1 and encodes a novel protein with a myosine-tail homologous domain and C-terminal DIX domain
12792787 MTHDIX (KIAA1735) protein consists of Myosine-tail homologous (MTH) domain and C-terminal DIX domain.

AA Sequence

MLACLTRGNLLDVLQEGFNEQQLQAYVAWVNAQLKKRPAVKPVQDLRQDLRDGVILAYLIEIVAGEKLSG      1 - 70
VQLSPGNQQEMKNNVEKVLQFVASKKIRMHQTSAKDIVDGNLKSIMRLVLALAAHFKPGSSRTVNQGRDS     71 - 140
RAPLQSHRPHCATAVAQGAAAALADVCHDMSRSGRDVFRYRQRNSSMDEEIENPYWSVRALVQQYEGQQR    141 - 210
SPSESSCSSLTSPSPIHSAKSESIITQSEEKADFVIIPAEGIENRTEGTDSPLSRDWRPGSPGTYLETSW    211 - 280
EEQLLEQQEYLEKEMEEAKKMISGLQALLLNGSLPEDEQERPLALCEPGVNPEEQLIIIQSRLDQSMEEN    281 - 350
QDLKKELLKCKQEARNLQGIKDALQQRLTQQDTSVLQLKQELLRANMDKDELHNQNVDLQRKLDERNRLL    351 - 420
GEYKKELGQKDRLLQQHQAKLEEALRKLSDVSYHQVDLERELEHKDVLLAHCMKREADEATNYNSHNSQS    421 - 490
NGFLLPTAGKGATSVSNRGTSDLQLVRDALRSLRNSFSGHDPQHHTIDSLEQGISSLMERLHVMETQKKQ    491 - 560
ERKVRVKSPRTQVGSEYRESWPPNSKLPHSQSSPTVSSTCTKVLYFTDRSLTPFMVNIPKRLEEVTLKDF    561 - 630
KAAIDREGNHRYHFKALDPEFGTVKEEIFHDDDAIPGWEGKIVAWVEEDHGEN                     631 - 683
//

Text Mined References (29)

PMID Year Title
25648220 2016 DIXDC1 activates the Wnt signaling pathway and promotes gastric cancer cell invasion and metastasis.
25042806 2014 An AMPK-independent signaling pathway downstream of the LKB1 tumor suppressor controls Snail1 and metastatic potential.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23813858 2014 DIXDC1 increases the invasion and migration ability of non-small-cell lung cancer cells via the PI3K-AKT/AP-1 pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22832659 2011 Abnormal behavior in mice mutant for the Disc1 binding partner, Dixdc1.
21189423 2011 Molecular basis of Wnt activation via the DIX domain protein Ccd1.
20823832 2010 Dishevelled, a Wnt signalling component, is involved in mitotic progression in cooperation with Plk1.
20624590 2010 Dixdc1 is a critical regulator of DISC1 and embryonic cortical development.
20213681 2010 Strategy for comprehensive identification of human N-myristoylated proteins using an insect cell-free protein synthesis system.
20085589 2010 Wnt signaling stabilizes the DIXDC1 protein through decreased ubiquitin-dependent degradation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19572978 2009 DIXDC1 targets p21 and cyclin D1 via PI3K pathway activation to promote colon cancer cell proliferation.
19519246 2009 A novel monoclonal antibody specific to DIXDC1 protein.
19375513 2009 DIXDC1 co-localizes and interacts with gamma-tubulin in HEK293 cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18629627 2009 DIXDC1 promotes retinoic acid-induced neuronal differentiation and inhibits gliogenesis in P19 cells.
16814745 2006 DIXDC1 isoform, l-DIXDC1, is a novel filamentous actin-binding protein.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15262978 2004 The DIX domain protein coiled-coil-DIX1 inhibits c-Jun N-terminal kinase activation by Axin and dishevelled through distinct mechanisms.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12934113 2003 Expression profiling and characterization of 4200 genes cloned from primary neuroblastomas: identification of 305 genes differentially expressed between favorable and unfavorable subsets.
12792787 2003 KIAA1735 gene on human chromosome 11q23.1 encodes a novel protein with myosine-tail homologous domain and C-terminal DIX domain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.