Property Summary

NCBI Gene PubMed Count 220
PubMed Score 270.65
PubTator Score 390.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
cutaneous lupus erythematosus 1.500 1.1e-02
lung cancer 3.000 8.4e-06

Gene RIF (236)

PMID Text
27333658 It is anterogradely transported to the neurite tips, together with Lis1, and functions in neurite extension via suppression of GSK3beta activity.
26615762 Hypoxic preconditioning decreases NF-kappaB activity via DISC1.
26553875 DISC1 acts as an important regulator of mitochondrial dynamics in both axons and dendrites.
26546129 These results uncover an unexpected role for DISC1 in normal beta-cell physiology and suggest that DISC1 dysregulation contributes to T2D independently of its importance for cognition.
26443054 DISC1 gene variations may affect the course of cognitive deficits found in patients suffering from the first episode of non-affective psychosis
26299970 DISC1 disruption affects expression of neural cell fate markers and Wnt signaling.
26206934 Transient neonatal disruption of signaling via the C-terminal domain of "disrupted in schizophrenia 1" (DISC1)-a molecule implicated in psychiatric disorders-resulted in a lack of long-term potentiation (LTP) (persistent strengthening of synapses) and experience-dependent potentiation in adulthood.
26162659 An association was found with DISC1 genetic variants and susceptibility to schizophrenia in a Han Chinese population.
26078884 Results indicate that the neurexin and neuroligin synaptic complex is intrinsically involved in the regulation of DISC1 function, thus contributing to a better understanding of the pathology of schizophrenia.
26062786 Results suggest that DISC1 interacts with BACE1 and promotes lysosomal degradation of BACE1, thus reducing the generation of Abeta
25821909 In Disc1-knockout mice, recombinant human DISC1 regulates the dendritic transport of Itpr1 mRNA by directly interacting with its mRNA.
25705664 we discuss the expression of DISC1, DBZ, and SGK1 , their roles in the regulation of oligodendrocyte function, possible interactions of DISC1 and DBZ in relation to SZ, and the activation of the SGK1 signaling cascade in relation to MDD.
25635053 DISC1 forms a complex with dysbindin and increases its stability in association with a reduction in ubiquitylation.
25620115 Results with immature neurons from patients with schizophrenia and bipolar disorder showed common alterations in DISC1 levels and its cellular distribution, cAMP homeostasis, and cell migration
25533973 We demonstrated that Ser704Cys-genotype of DISC1 influences (para)hippocampal structure and functioning the dorsal PFC during executive planning, most prominently in unaffected controls
25433637 Dopamine d2 receptor-Disrupted in schizophrenia 1 complex levels are increased in conjunction with decreased GSK-3 phosphorylation in postmortem brain tissue from schizophrenics.
25218871 results demonstrate that DISC1 protein levels in human lymphocytes are correlated with the diagnosis of schizophrenia independent of smoking and thus present a potential biomarker
25092219 These results suggested a possible role of the DISC1 genotype in the early neurodevelopment of human brains, but failed to show its specific role in the neurodevelopmental pathology of schizophrenia.
25043320 In the adult mammalian brain DISC1 plays a critical role in neurite outgrowth and neuronal migration, particularly in the hippocampus.
25016072 Review describes functional roles of DISC1 and its molecular complexes in the brain and DISC1-associated mental disorders in the context of DISC1 and its interacting proteins
25012417 findings suggest that morphological changes in the hippocampus, ACC, and/or striatum of MDD patients do not represent neurobiological mechanisms underlying the association between DISC1 and MDD
24940743 These findings highlight the importance of the coordinated expression of DISC1-interactome genes for normal cognitive function.
24934694 DISC1 knockdown leads to a reduction of VGF in neurons.
24909300 This study provided that DISC1 genetic variants reveals a relationship with the structure and functional connectivity of the precuneus in schizophrenia.
24908665 Expression of the DB7 fusion gene may reduce protein translation to impair brain functions and thereby contribute to the pathogenesis of major psychiatric disorders.
24770450 The current study examined whether anhedonia is associated with DISC1 polymorphisms in a clinically enriched sample of 346 schizophrenia probands.
24474471 Results demonstrate that PAK7 is developmentally co-expressed with another known psychosis risk gene (DISC1) suggesting a potential molecular mechanism involving aberrant synapse development and plasticity.
24289909 The functional Ser704Cys variant of DISC1 was nominally associated with completed suicide. Enhanced evidence of association was observed in a multi-marker sliding window haplotype analysis.
24219803 A possible link is discovered between a DISC1 mutation and the cannabinoid system in a mouse model of schizophrenia.
24169524 Data indicate four predicted polymorphic miR-135b-5p target sites in the disrupted-in-schizophrenia-1 (DISC1) 3'UTR, and that miR-135b-5p regulates the level of DISC1 mRNA.
24146131 The results of this student findings provide consistent evidence that the DISC1 Ser704Cys polymorphism influences the thalamic-prefrontal circuits in humans.
24092329 Details of a robust association of DISC1 with mitochondrial transport complexes containing TRAK1 and Miro1.
24090488 Our results revealed association between rare haplotypes and affective disorder providing further support to the hypothesis that DISC1 sequence variations may be related to AD susceptibility
24013095 These results provide evidence that the Ser704Cys functional genetic variation of DISC1 does not underlie the pathophysiology of schizophrenia in the Japanese population.
23921125 Altered hippocampal area function and coupling in DISC1 and SLC12A2 minor allele carriers.
23855403 The results reinforce the role of DISC1 in the association of schizophrenia
23832957 [review] DISC1 is found to have many but not all of the characteristics of a scaffold protein, as it affects a considerable number of different but related signaling pathways, in most cases through inhibition of key enzymes.
23732877 Study provides comprehensive landscape of genetic variation at DISC1 locus in patients with schizophrenia, bipolar disorder and recurrent major depressive disorder and in healthy population controls with quantitative measures of mood and cognition
23637159 This study found specific interactions between discrete genetic (Disc1-L100P(+/-)) and environmental factors (MIA) that exacerbate schizophrenia-related phenotypes.
23602339 Disrupted-in-Schizophrenia 1 (DISC1) is a well researched candidate gene for schizophrenia and affective disorders with a range of functions relating to neurodevelopment.
23581481 We report three short tandem repeat (STR) loci ((ATCC)n1, D1S1621, and (ATCC)n2) in DISC1 that showed a significant association with schizophrenia in a set of Chinese Han individuals.
23497821 no convincing evidence that DISC1 affects schizophrenia development, but findings may be useful for further genetic studies
23481583 This study indicated that truncations of Disc1 alter glutamatergic and GABAergic neurotransmission both commonly and differently in the models and some of the effects are sex-specific, revealing how altered Disc1 expression in schizophrenia.
23389941 association between DISC1 variants and ADHD
23379509 Studies indicate that DISC1 and AKT were invlved in the regulation of GSK3beta and Wnt signaling paathway.
23347445 Features of acute symptoms in schizophrenia are not influenced by the polymorphisms on the DISC1 gene, but are influenced by recent adverse life events and emotional abuse at childhood.
23283688 Neonates homozygous for the DISC1 (rs821616) serine allele exhibited numerous large clusters of reduced gray matter in the frontal lobes.
23253390 DISC1 is a putative susceptibility gene for a spectrum of major psychiatric disorders such as schizophrenia
23233134 Pulldown studies in human cells using Myc-tagged Tensin2 constructs revealed that DISC1 specifically interacts with the C-terminal PTB domain of Tensin2 in a phosphorylation-independent manner.
23140672 This study demonistrated that DISC1 (disrupted-in-schizophrenia 1) is associated with cortical grey matter volumes in the human brain.
23011268 Neurobiological changes accompanied social anhedonia in the nucleus accumbens of DISC1-Q31L mutant mice.
22901592 This study revealed no significant evidence of association between SCZ and the two non-synonymous SNPs, rs3738401 and rs821616.
22869032 This study provides further evidence of association between DISC1 and recurrent major depression and for an effect of expression level on age of onset.
22832604 Complexes of full-length DISC1 with truncated DISC1 variants may result in cellular disturbances critical to DISC1 function in schizophrenia.
22815203 DISC1 single nucleotide polymorphisms might impact brain structural variation, possibly differently in psychosis patients versus controls.
22801410 Transgenic expression of mutant DISC1 in astrocytes depletes serine racemase and D-serine.
22693340 we investigated the brain anatomical networks of 278 healthy volunteers with different genotypes in the common missense variant (Ser704Cys) of the Disrupted-in-Schizophrenia-1 (DISC1) gene
22659396 This study found that Disc1-L100P +/- and wild-type mice have similar anxiety responses to CSD, while Q31L +/- mice had a very different response.
22547224 in lymphoblastoid cell lines, the translocation additionally results in the production of abnormal transcripts due to the fusion of DISC1 with a disrupted gene on chromosome 11
22516458 The DISC1 variant rs821597 may confer risk for schizophrenia by its effects on the regional gray matter in left parahippocampal gyrus and right orbitofrontal cortex with other risk factors for schizophrenia in Han Chinese population.
22472875 The results of this study discoveried DISC1 was not found to contain common or uncommon variants individually, or in aggregate associated with schizophrenia.
22434823 study demonstrates inhibition of DISC1 promoter activity and protein expression by forkhead-box P2, a transcription factor implicated in speech and language function.
22422769 Data show that Disrupted-In-Schizophrenia 1 (DISC1) interacts with the transcription factor activating transcription factor 4 (ATF4) in the nucleus, and the common variant 607F additionally reduces DISC1/ATF4 interaction.
22385968 Study uncovers an interplay between intrinsic DISC1 and extrinsic GABA signaling, two schizophrenia susceptibility pathways.
22363459 DISC1 conditioned genome-wide association study for psychosis proneness in a large Finnish birth cohort.
22337479 The effects of the DISC1 Leu(607) Phe polymorphism on brain activation in young healthy individuals at familial risk of bipolar disorder, in a group of controls and in a group at familial risk of schizophrenia performing a language task, was examined.
22291444 large DISC1 aggregates have a pathological effect in neurons by causing the disruption of intracellular transport of key organellar cargo, such as mitochondria
22099459 DISC1 regulates distinct aspects of neuronal development through its interaction with different intracellular partners and such epistasis may contribute to increased risk for schizophrenia.
22099458 DISC1 variants impair Wnt signaling and brain development and elucidate a possible mechanism for their role in neuropsychiatric phenotypes.
22095064 The describation of this review that the linking neurodevelopmental and synape of mental disorders through DISC1.
22015021 DISC1 has been firmly established as a genetic risk factor for a spectrum of psychiatric illness. (Review)
21998303 DISC1 forms octamers via dimers as building blocks. S704C forms higher-order oligomers, without affecting its affinity with NDEL1
21878470 The P300 waveform appears to be modulated by variation in individual single nucleotide polymorphisms (SNPs) and haplotypes of DISC1.
21853134 The contribution of genetic variation in DISC1 and 10 of its interaction partners to schizophrenia susceptibility in an isolated northern Swedish population, is reported.
21739582 our results suggest a significant role for DISC1 in corpus callosum development
21642004 This study provides convergent evidence for the effect of DISC1 risk variants on two independent brain-based intermediate phenotypes of schizophrenia
21605958 The results suggest that the expression of DeltahDISC1 exerts a significant influence on oligodendrocyte differentiation and function, evidenced by premature OLG differentiation and increased proliferation of their progenitors.
21569632 study provides evidence that the DISC1 may be the susceptibility gene of autism.
21483435 found no evidence that common variants at the DISC1 locus are associated with schizophrenia.
21483430 Several DISC1 polymorphisms were associated with cortical gray matter thickness in the parietal, temporal & frontal lobes. Working memory, depression & were associated with DISC1 sequence variation.
21471969 a dual role for DISC1 in corticogenesis and indicate that phosphorylation of this protein at S710 activates a key developmental switch
21445958 In sequencing exon 11 in 506 schizoaffective spectrum cases and 1,211 controls for variants that occurred only once, 4 additional rare variants were found in cases
21376542 This study provided a better understanding of the neural effects of DISC1 variants and on the pathophysiology of schizophrenia and bipolar disorder.
21368031 Disc1 transgenic mice with point mutations (Q31L and L100P) display a relative reduction in neuron number, decreased neurogenesis, and altered neuron distribution compared to wild-type littermates.
21358711 The results of this study supported a similarly important role for DISC1 in white matter development in humans.
21315744 Perturbations in DISC1 functions in the ventral striatum may impact the molecular mechanisms of reward and sensitization, contributing to comorbidity between drug abuse and major mental diseases.
21298101 finding of a high degree of connectivity between the DISC1 scaffold protein, linked to psychiatric illness, and huntingtin
21256178 results showed that DISC1 had no apparent degree of association with Japanese patients with schizophrenia as a candidate susceptibility gene for disease per se or treatment-resistant schizophrenia
21222298 This finding provides evidence supporting the role of DISC1 gene in bipolar disorder, and shows the presence of population heterogeneity.
21149852 relating genetic variation in the DISC1 pathway to functional and structural studies of the brain in humans and in the mouse [Review]
21091867 In contrast to its effect in healthy subjects, variation in DISC1 Cys704Ser704 genotype is not associated with altered prefrontal activation in patients with schizophrenia or bipolar disorder.
21079610 This study reported a novel role for DISC1 in regulating the axonal transport of mitochondria and also show that the disease-associated Leu607Phe polymorphism disrupts this function.
21041608 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20956536 CAMDI is required for radial migration probably through DISC1 and myosin II-mediated centrosome positioning during neuronal development.
20880836 DISC1 plays essential roles for mitochondrial function in collaboration with a mitochondrial interacting partner, Mitofilin.
20850505 Data in this review are consistent with high frequency of depression in a large Scottish family with a translocation disrupting DISC1 and linkage disequilibrium analysis showing haplotypes associated with small increases in risk for bipolar disorder.
20850505 Observational study of gene-disease association. (HuGE Navigator)
20691427 Observational study of gene-disease association. (HuGE Navigator)
20666147 DISC1 together with Hzf interacts with a specific mRNAs such as IP3R1 mRNA and regulates their dendritic transport via Kinesin-1 and translation as a component of RNA granules.
20628343 DISC1 affects the maturation of front-temporal cortical systems.
20628343 Observational study of gene-disease association. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20574532 Observational study of gene-disease association. (HuGE Navigator)
20531939 These results identify a role of DISC1 in regulating the formation and/or maintenance of primary cilia, and establish subtype-specific targeting of dopamine receptors to the ciliary surface.
20531374 Results suggest that the DISC1 rs3738401 missense variant is statistically linked with ultra-resistance to antipsychotic treatment.
20531374 Observational study of gene-disease association. (HuGE Navigator)
20505556 The analysis adds convergent evidence in favor of a significant role of the DISC1 gene as a risk factor for schizophrenia.
20505556 Observational study of gene-disease association. (HuGE Navigator)
20398908 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20360304 DISC1 coding variants modulate centrosomal PCM1 localization, highlight a role for DISC1 in glial function and provide a possible cellular mechanism contributing to the association of these DISC1 variants with psychiatric phenotypes.
20360304 Observational study of gene-disease association. (HuGE Navigator)
20351714 Observational study of gene-disease association. (HuGE Navigator)
20227423 In summary, the Cys704 allele of Ser704Cys SNP was associated with an increased risk of chronic fatigue syndrome development compared with the Ser704 allele
20227423 Observational study of gene-disease association. (HuGE Navigator)
20212127 DISC1 is expressed in neurons, astrocytes, oligodendrocytes, microglia, and progenitors. These findings may connect NRG1, ErbBs, Akt, and DISC1 in a common pathway, which may regulate neurodevelopment and contribute to susceptibility to schizophrenia.
20168324 We have shown that rs821577, either independently or in the presence of the risk allele for SNP rs821633, is associated with increased anxiety and depression and with higher levels of neuroticism,in women,in two cohorts of older normal individuals
20168324 Observational study of gene-disease association. (HuGE Navigator)
20084519 Evidence of statistical epistasis between DISC1, CIT and NDEL1 impacting risk for schizophrenia: biological validation with functional neuroimaging.
20084519 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20048751 The results of this study showed that the differential neurobehavioral effects of mutant hDISC1 depend on when across neurodevelopment expression of the protein occurs.
19944766 Observational study of gene-disease association. (HuGE Navigator)
19913623 NRG1 and DISC1 genes may be associated with brain abnormalities in schizophrenia
19913623 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19805229 Schizophrenia risk-associated polymorphisms [non-synonymous SNPs rs821616 (Cys704Ser) and rs6675281 (Leu607Phe), and rs821597] were associated with the expression of Delta3 and Delta7Delta8.
19782967 DISC1 shows an association with the schizophrenia spectrum disorder diagnosis.
19782967 Observational study of gene-disease association. (HuGE Navigator)
19693267 Observational study of gene-disease association. (HuGE Navigator)
19632097 This study found that DISC1 variants, particularly in the exon 9/intron 9/intron 10 region of the gene, may be associated with risk for schizophrenia in our sample population.
19632097 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19586833 significant association between schizophrenia and the DISC1 gene in the Taiwanese sample was not caused by balance translocation, but rather by polymorphic variations of the gene to be detected.
19583211 Results suggest that assembly of the C-terminal domain of DISC1 is controlled by distinct domains including the disease-associated polymorphism 704 and is functional in vivo.
19548263 Observational study of gene-disease association. (HuGE Navigator)
19502360 Electroporation of hDisc1 shRNA into the developing mouse hippocampus hinders the migration of dentate gyrus granule cells.
19455170 DISC1 Leu607Phe substitution is a functional variant, impacting on both centrosomal and synaptic function
19414483 DISC1 intron 9 interval was associated with schizophrenia in females and contributed strongly to early-onset cases.
19414483 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19367581 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19352214 results suggested that three coding SNPs (rs3738401, rs3738402, and rs821616) of DISC1 may not be involved in the development of austism spectrum disorders in Korean population
19328558 Observational study of gene-disease association. (HuGE Navigator)
19304459 Our findings also suggest that the DISC1 genotype variation might have some relevance to the medication effect on brain morphology in schizophrenia.
19304459 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19303846 Study demonstrates that suppression of DISC1 expression reduces neural progenitor proliferation, leading to premature cell cycle exit and differentiation; several lines of evidence suggest that DISC1 mediates this function by regulating GSK3beta.
19300510 Results provide evidence for the relevance of the DISC1 pathway to major mental illness, identify additional potential targets for therapeutic intervention and establish a general strategy to mine public datasets for insights into disease pathways.
19255581 Observational study of gene-disease association. (HuGE Navigator)
19251251 Our findings with other converging lines of evidence support the underlying importance of DISC1-related molecular pathways in the etiology of schizophrenia and other major mental illnesses
19191256 The association of PCNT2 and DBZ with schizophrenia and bipolar disorder in a case-control study of Japanese cohorts, was examined.
19191256 Observational study of gene-disease association. (HuGE Navigator)
19188535 Variants in DISC1 affect the level of social anhedonia, a cardinal symptom of schizophrenia in the general population.
19188535 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
19077115 Observational study of gene-disease association. (HuGE Navigator)
19046394 These findings suggest that the Ser(704)Cys DISC1 polymorphism is physiologically relevant. Moreover, they support the hypothesis that genetic variation in DISC1 may affect the risk for schizophrenia by modifying hippocampal gray matter and function.
19046394 Observational study of gene-disease association. (HuGE Navigator)
18983980 NDE1, NDEL1 and LIS1, together with their binding partner dynein, associate with DISC1, PDE4B and PDE4D within the cell, and provide evidence that this complex is present at the centrosome.
18955030 These findings suggest that the DISC1-kendrin interaction plays a key role in the microtubule dynamics.
18818052 Our results suggest that a relatively uncommon DISC1 mutation, which increases the susceptibility for schizophrenia may be segregating in the Scandinavian population.
18818052 Observational study of gene-disease association. (HuGE Navigator)
18800054 his study found that both Ser704 homozygotes and Cys704 carriers showed bilateral activation in the pre-frontal cortex during the verbal fluency task, with greater engagement of the left hemisphere than the right
18800054 Observational study of gene-disease association. (HuGE Navigator)
18762586 DISC1 gene is disrupted in schizophrenia
18620078 Disc1 is expressed throughout the hippocampus during embryonic development, with expression becoming increasingly specialized in Ammon's horn and dentate gyrus granule cells within the first postnatal week.
18583979 Meta-analysis of gene-disease association. (HuGE Navigator)
18497105 Data supports Disrupted in Schizophrenia 1 (DISC1) as a schizophrenia risk gene of great significance for schizophrenia and its underlying biology.[REVIEW]
18474207 Disrupted-in-Schizophrenia-1 (DISC1) is now an important candidate risk gene for schizophrenia and affective disorders.
18469341 NDEL1 significantly influences risk for schizophrenia via an interaction with DISC1.
18469341 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18400883 For DISC1-related sporadic psychiatric disease, impaired cellular control over self-association of DISC1 leads to excessive multimerization and subsequent formation of detergent-resistant aggregates, with loss of ligand binding, exemplified by NDEL1.
18395819 translocation disrupting the DISC 1 gene segregates with schizophrenia and related psychiatric disorders in a large Scottish family
18395819 Observational study of gene-disease association. (HuGE Navigator)
18317464 The data of this study provided further genetic support for a role of DISC1 in psychiatric illness, with the same variants on the same gene modulating risk to both bipolar disorder and schizophrenia.
18317464 Observational study of gene-disease association. (HuGE Navigator)
18270998 data demonstrate that DISC1 is not imprinted in the adult human brain, and strongly suggest that reports of genetic association between DISC1 and psychiatric disorder are not explicable by sequence changes that alter mRNA abundance
18198266 Observational study of gene-disease association. (HuGE Navigator)
18180429 Observational study of gene-disease association. (HuGE Navigator)
18180429 results suggest novel candidates and 1 gene (DISC1) previously associated with schizophrenia that merit further study in bipolar disorder
18164685 Observational study of gene-disease association. (HuGE Navigator)
18164685 We conclude that ultra-rare structural variants in DISC1 are associated with an attributable risk of about 2% for schizophrenia. We also confirm that two common structural variants (Q264R and S704C) elevate the risk for schizophrenia slightly.
18078707 these findings implicate DISC1 in variations of prefrontal cortical volume confeing increased risk for schizophrenia
18078707 Observational study of gene-disease association. (HuGE Navigator)
18075479 Single nuleotide polymorphism in the 5' upstream region is not associated with mood disorders.
17997036 DISC1 may be a susceptibility gene for poor concentration among Korean patients with schizophrenia.
17997036 Observational study of gene-disease association. (HuGE Navigator)
17912248 DISC1 is a hub protein in a multidimensional risk pathway for major mental illness, and studies of this pathway are opening up opportunities for a better understanding of causality and possible mechanisms of intervention [review].
17823207 Altered DISC1-PDE4B interaction may thus underlie the symptoms of some cases of schizophrenia and depression.(Review)
17673452 Allelic heterogeneity within DISC1 leading to heterogeneity in psychotic and bipolar spectrum disorders.
17673452 Observational study of gene-disease association. (HuGE Navigator)
17579608 The involvement of DISC1 gene in the etiopathogenesis of autism and Asperger syndrome.
17579608 Observational study of gene-disease association. (HuGE Navigator)
17286247 Observational study of gene-disease association. (HuGE Navigator)
17286247 Further evidence for DISC1 as a predisposing gene involved in schizophrenia in the Chinese Han Population.
17185386 Observational study of gene-disease association. (HuGE Navigator)
17185386 Two additional loci displayed an evidence of linkage (LOD > 3) and included a locus on 16p13, proximal to the gene encoding NDE1, which has been shown to biologically interact with DISC1.
17117617 these data suggest involvement of genetically linked abnormalities in the DISC1 molecular pathway in the pathophysiology of schizophrenia--{REVIEW}
17055463 Observational study of gene-disease association. (HuGE Navigator)
17043677 DISC1 looks to have a protein interaction profile consistent with that of an essential synaptic protein
17006672 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17006672 SNPs in RGS4, G72, GRM3, and DISC1 showed evidence for significant statistical epistasis with COMT.
16997000 Observational study of gene-disease association. (HuGE Navigator)
16997000 chromosome 1q42.1 harbors GNPAT and DISC1 as candidate genes for schizophrenia, and DISC1 is associated with sustained attention deficits.
16959794 Observational study of gene-disease association. (HuGE Navigator)
16959794 Study found that Cys704 allele of the Ser704Cys single-nucleotide polymorphism (SNP) was associated with an increased risk of developing major depressive disorder and strong evidence for association in a multi-marker haplotype analysis with this SNP.
16936759 Located on chromosome 1, a region implicated in schizophrenia, and bipolar disorders.
16936715 Observational study of gene-disease association. (HuGE Navigator)
16843095 DISC1 has emerged as a key molecular player in the etiology of major mental illness and in normal brain processes--{REVIEW}
16814263 Decreased mRNA levels of DISC1 expression, associating with the risk haplotype, may be implicated in the pathophysiology of bipolar disorder.
16736468 DISC1 immunoreactivity was examined in frontal and parietal cortex in normal adult human brain. DICS1 is prevalent throughout the cortical layers in neurons, axon terminals, and postsynaptic targets.
16524593 Observational study of gene-disease association. (HuGE Navigator)
16510495 We found no difference in the expression of DISC1 or reelin mRNA in schizophrenia and no association with previously identified risk DISC1 SNPs
16389590 Observational study of gene-disease association. (HuGE Navigator)
16389590 Results further strengthen the candidacy of DISC1 as a risk factor for schizophrenia in the general population, and suggest that more intensive searching for causative variants is justified.
16293762 a mechanistic model whereby DISC1 sequesters phosphodiesterase 4B in resting cells and releases it in an activated state in response to elevated cAMP
16275808 Observational study of gene-disease association. (HuGE Navigator)
16243297 Furthermore, we found that overexpression of DISC1 in SH-SY5Y cells induces the assembly of eIF3- and TIA-1-positive stress granules (SGs), discrete cytoplasmic granules formed in response to environmental stresses.
16209927 DISC1 over-expression produces striking mitochondrial reorganization in some cells, with formation of mitochondrial ring-like structures, indicating a potential involvement of DISC1 in mitochondrial fusion and/or fission.
16103888 Results provide genetic support that the DISC1 gene contributes to sensitivity to schizophrenia and associated disturbances and affects short-term visual memory functions.
16056147 Observational study of gene-disease association. (HuGE Navigator)
16056147 These data suggest that DISC1 is associated with neurocognitive functioning in schizophrenia.
16054297 Observational study of gene-disease association. (HuGE Navigator)
16054297 Variation in DISC1 may therefore affect cognitive aging especially in women.
16039834 Observational study of gene-disease association. (HuGE Navigator)
15940305 Possibility that mutations in the DISC1 gene can increase the risk for schizophrenia and related disorders.
15939883 Allelic variation within DISC1, either at Ser704Cys or haplotypes monitored by it, increases the risk for schizophrenia through the involvement of structural and functional alterations in the hippocampal formation.
15838535 Results provide further supporting evidence for DISC1 as a susceptibility factor for both bipolar disorder and schizophrenia.
15797709 This is first direct evidence that DISC1 is localized to mitochondria in cultured cortical neurons that are dependent on an intact cytoskeleton.
15728732 DISC1 inhibits NUDEL-oligopeptidase activity in a competitive fashion.
15386212 Observational study of gene-disease association. (HuGE Navigator)
15386212 Variation at the DISC1 locus predisposes individuals to a variety of psychiatric disorders.
15342131 Observational study of gene-disease association. (HuGE Navigator)
15184103 subjects with schizophrenia who carry the t (1;11) translocation have similar phenotype to unrelated subjects with schizophrenia and a normal karyotype.
15121183 Mitochondria are the predominant site of DISC1 expression with additional nuclear, cytoplasmic, and actin-associated locations evident.
14623284 The cellular roles of the proteins identified implicate DISC1 in several aspects of central nervous system development and function, including gene transcription, mitochondrial function, modulation of the actin cytoskeleton, and neuronal migration.
14532331 Disc1 was genotyped using snps to determine its association to schizophrenia.
12874605 DISC1 interacts with FEZ1 through a binding site at AA 446-633.
12812986 DISC1 is a multifunctional protein whose truncation contributes to schizophrenia susceptibility by disrupting intracellular transport, neurite architecture and/or neuronal migration
12506198 Mutant truncation prevents binding to NudE-like (NUDEL) and inhibits neurite outgrowth

AA Sequence

MPGGGPQGAPAAAGGGGVSHRAGSRDCLPPAACFRRRRLARRPGYMRSSTGPGIGFLSPAVGTLFRFPGG      1 - 70
VSGEESHHSESRARQCGLDSRGLLVRSPVSKSAAAPTVTSVRGTSAHFGIQLRGGTRLPDRLSWPCGPGS     71 - 140
AGWQQEFAAMDSSETLDASWEAACSDGARRVRAAGSLPSAELSSNSCSPGCGPEVPPTPPGSHSAFTSSF    141 - 210
SFIRLSLGSAGERGEAEGCPPSREAESHCQSPQEMGAKAASLDGPHEDPRCLSRPFSLLATRVSADLAQA    211 - 280
ARNSSRPERDMHSLPDMDPGSSSSLDPSLAGCGGDGSSGSGDAHSWDTLLRKWEPVLRDCLLRNRRQMEV    281 - 350
ISLRLKLQKLQEDAVENDDYDKAETLQQRLEDLEQEKISLHFQLPSRQPALSSFLGHLAAQVQAALRRGA    351 - 420
TQQASGDDTHTPLRMEPRLLEPTAQDSLHVSITRRDWLLQEKQQLQKEIEALQARMFVLEAKDQQLRREI    421 - 490
EEQEQQLQWQGCDLTPLVGQLSLGQLQEVSKALQDTLASAGQIPFHAEPPETIRSLQERIKSLNLSLKEI    491 - 560
TTKVCMSEKFCSTLRKKVNDIETQLPALLEAKMHAISGNHFWTAKDLTEEIRSLTSEREGLEGLLSKLLV    561 - 630
LSSRNVKKLGSVKEDYNRLRREVEHQETAYETSVKENTMKYMETLKNKLCSCKCPLLGKVWEADLEACRL    631 - 700
LIQSLQLQEARGSLSVEDERQMDDLEGAAPPIPPRLHSEDKRKTPLKVLEEWKTHLIPSLHCAGGEQKEE    701 - 770
SYILSAELGEKCEDIGKKLLYLEDQLHTAIHSHDEDLIQSLRRELQMVKETLQAMILQLQPAKEAGEREA    771 - 840
AASCMTAGVHEAQA                                                            841 - 854
//

Text Mined References (220)

PMID Year Title
27333658 2016 [When we have learned about the brain development from a disease-oriented study: DBZ regulates cortical cell positioning and neurite extension by sustaining the anterograde transport of Lis1/DISC1 through control of Ndel1 phosphorylation].
26615762 2016 Hypoxic preconditioning decreases nuclear factor ?B activity via Disrupted in Schizophrenia-1.
26553875 2016 DISC1-dependent Regulation of Mitochondrial Dynamics Controls the Morphogenesis of Complex Neuronal Dendrites.
26546129 2016 Beyond the brain: disrupted in schizophrenia 1 regulates pancreatic ?-cell function via glycogen synthase kinase-3?.
26443054 2015 Effect of DISC1 polymorphisms on the long-term course of neurocognitive deficits in non-affective psychosis.
26299970 2015 Genomic DISC1 Disruption in hiPSCs Alters Wnt Signaling and Neural Cell Fate.
26206934 2015 NEURODEVELOPMENT. Adult cortical plasticity depends on an early postnatal critical period.
26162659 2015 New findings support the association of DISC1 genetic variants with susceptibility to schizophrenia in the Han Chinese population.
26078884 2015 Neurexin-Neuroligin Synaptic Complex Regulates Schizophrenia-Related DISC1/Kal-7/Rac1 "Signalosome".
26062786 2016 Disrupted-in-Schizophrenia-1 Attenuates Amyloid-? Generation and Cognitive Deficits in APP/PS1 Transgenic Mice by Reduction of ?-Site APP-Cleaving Enzyme 1 Levels.
25821909 2015 Disrupted-in-schizophrenia 1 regulates transport of ITPR1 mRNA for synaptic plasticity.
25705664 2015 Disturbance of oligodendrocyte function plays a key role in the pathogenesis of schizophrenia and major depressive disorder.
25635053 2015 Disrupted-in-schizophrenia 1 (DISC1) regulates dysbindin function by enhancing its stability.
25620115 2015 Altered subcellular distribution of the 75-kDa DISC1 isoform, cAMP accumulation, and decreased neuronal migration in schizophrenia and bipolar disorder: implications for neurodevelopment.
25533973 2015 DISC1 gene and affective psychopathology: a combined structural and functional MRI study.
25433637 2014 A dopamine D2 receptor-DISC1 protein complex may contribute to antipsychotic-like effects.
25218871 2014 Peripheral DISC1 protein levels as a trait marker for schizophrenia and modulating effects of nicotine.
25092219 2015 The Disrupted-in-Schizophrenia-1 Ser704Cys polymorphism and brain neurodevelopmental markers in schizophrenia and healthy subjects.
25043320 2014 DISC1-TSNAX and DAOA genes in major depression and citalopram efficacy.
25016072 2014 Disrupted-In-Schizophrenia-1 (DISC1) interactome and mental disorders: impact of mouse models.
25012417 2014 No evidence of DISC1-associated morphological changes in the hippocampus, anterior cingulate cortex, or striatum in major depressive disorder cases and healthy controls.
24940743 2014 Expression of DISC1-interactome members correlates with cognitive phenotypes related to schizophrenia.
24934694 2014 Neuropeptide precursor VGF is genetically associated with social anhedonia and underrepresented in the brain of major mental illness: its downregulation by DISC1.
24909300 2014 A brain-wide association study of DISC1 genetic variants reveals a relationship with the structure and functional connectivity of the precuneus in schizophrenia.
24908665 2014 Inhibition of protein translation by the DISC1-Boymaw fusion gene from a Scottish family with major psychiatric disorders.
24770450 2014 DISC1 loci not associated with anhedonia in individuals with genetic liability for schizophrenia.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24474471 2014 An inherited duplication at the gene p21 Protein-Activated Kinase 7 (PAK7) is a risk factor for psychosis.
24289909 2014 Haplotype analysis of the DISC1 Ser704Cys variant in Japanese suicide completers.
24219803 2014 Dominant negative DISC1 mutant mice display specific social behaviour deficits and aberration in BDNF and cannabinoid receptor expression.
24169524 2014 Allele-specific regulation of DISC1 expression by miR-135b-5p.
24146131 2015 DISC1 Ser704Cys impacts thalamic-prefrontal connectivity.
24092329 2014 DISC1 complexes with TRAK1 and Miro1 to modulate anterograde axonal mitochondrial trafficking.
24090488 2013 Transmission disequilibrium of DISC1 haplotypes in Bulgarian families with affective disorder.
24013095 2013 Association analysis of the DISC1 gene with schizophrenia in the Japanese population and DISC1 immunoreactivity in the postmortem brain.
23921125 2013 DISC1 and SLC12A2 interaction affects human hippocampal function and connectivity.
23855403 2014 Deep resequencing of 17 glutamate system genes identifies rare variants in DISC1 and GRIN2B affecting risk of opioid dependence.
23832957 2013 Revisiting disrupted-in-schizophrenia 1 as a scaffold protein.
23732877 2014 708 Common and 2010 rare DISC1 locus variants identified in 1542 subjects: analysis for association with psychiatric disorder and cognitive traits.
23637159 2013 Maternal immune activation during gestation interacts with Disc1 point mutation to exacerbate schizophrenia-related behaviors in mice.
23602339 2013 Human brain imaging studies of DISC1 in schizophrenia, bipolar disorder and depression: a systematic review.
23581481 2013 Association study of three microsatellite polymorphisms located in introns 1, 8, and 9 of DISC1 with schizophrenia in the Chinese Han population.
23497821 2013 Lack of association between DISC1 polymorphisms and risk of schizophrenia in a Korean population.
23481583 2013 Frontal cortical synaptic communication is abnormal in Disc1 genetic mouse models of schizophrenia.
23389941 2013 DISC1 in adult ADHD patients: an association study in two European samples.
23379509 2013 An emerging role for Wnt and GSK3 signaling pathways in schizophrenia.
23347445 2013 Effects of the adverse life events and Disrupted in Schizophrenia-1 (DISC1) gene polymorphisms on acute symptoms of schizophrenia.
23283688 2014 Common variants in psychiatric risk genes predict brain structure at birth.
23253390 2013 Progress in imaging the effects of psychosis susceptibility gene variants.
23233134 2013 Interaction of DISC1 with the PTB domain of Tensin2.
23140672 2013 DISC1 (disrupted-in-schizophrenia 1) is associated with cortical grey matter volumes in the human brain: a voxel-based morphometry (VBM) study.
23011268 2013 Disrupted-in-schizophrenia-1 Gln31Leu polymorphism results in social anhedonia associated with monoaminergic imbalance and reduction of CREB and ?-arrestin-1,2 in the nucleus accumbens in a mouse model of depression.
22901592 2012 Meta-analysis of association studies between DISC1 missense variants and schizophrenia in the Japanese population.
22869032 2013 Association of DISC1 variants with age of onset in a population-based sample of recurrent major depression.
22832604 2011 Interactions of human truncated DISC1 proteins: implications for schizophrenia.
22815203 2012 Effect of DISC1 SNPs on brain structure in healthy controls and patients with a history of psychosis.
22801410 2013 Pathogenic disruption of DISC1-serine racemase binding elicits schizophrenia-like behavior via D-serine depletion.
22693340 2013 Less efficient information transfer in Cys-allele carriers of DISC1: a brain network study based on diffusion MRI.
22659396 2012 Social defeat interacts with Disc1 mutations in the mouse to affect behavior.
22547224 2012 A t(1;11) translocation linked to schizophrenia and affective disorders gives rise to aberrant chimeric DISC1 transcripts that encode structurally altered, deleterious mitochondrial proteins.
22516458 2012 The effect of DISC1 on regional gray matter density of schizophrenia in Han Chinese population.
22472875 2013 Deep resequencing and association analysis of schizophrenia candidate genes.
22434823 2012 The DISC1 promoter: characterization and regulation by FOXP2.
22422769 2012 DISC1 variants 37W and 607F disrupt its nuclear targeting and regulatory role in ATF4-mediated transcription.
22385968 2012 Interplay between DISC1 and GABA signaling regulates neurogenesis in mice and risk for schizophrenia.
22363459 2012 DISC1 conditioned GWAS for psychosis proneness in a large Finnish birth cohort.
22337479 2012 Effects of a mis-sense DISC1 variant on brain activation in two cohorts at high risk of bipolar disorder or schizophrenia.
22291444 2012 Disrupted in Schizophrenia 1 forms pathological aggresomes that disrupt its function in intracellular transport.
22228767 2012 CHCM1/CHCHD6, novel mitochondrial protein linked to regulation of mitofilin and mitochondrial cristae morphology.
22099459 2011 Interaction between FEZ1 and DISC1 in regulation of neuronal development and risk for schizophrenia.
22099458 2011 Common DISC1 polymorphisms disrupt Wnt/GSK3? signaling and brain development.
22095064 2011 Linking neurodevelopmental and synaptic theories of mental illness through DISC1.
22015021 2011 DISC1 at 10: connecting psychiatric genetics and neuroscience.
21998303 2011 Molecular characterization of disrupted in schizophrenia-1 risk variant S704C reveals the formation of altered oligomeric assembly.
21878470 2013 Effect of DISC1 on the P300 waveform in psychosis.
21853134 2011 Sequencing of DISC1 pathway genes reveals increased burden of rare missense variants in schizophrenia patients from a northern Swedish population.
21739582 2011 Genetic and functional analyses identify DISC1 as a novel callosal agenesis candidate gene.
21659360 2011 Association between single nucleotide polymorphism-genotype and outcome of patients with chronic lymphocytic leukemia in a randomized chemotherapy trial.
21642004 2011 DISC1 is associated with cortical thickness and neural efficiency.
21605958 2011 Expression of mutant human DISC1 in mice supports abnormalities in differentiation of oligodendrocytes.
21569632 2011 Evidence for association between Disrupted-in-Schizophrenia 1 (DISC1) gene polymorphisms and autism in Chinese Han population: a family-based association study.
21483435 2012 Meta-analysis indicates that common variants at the DISC1 locus are not associated with schizophrenia.
21483430 2011 Impact of DISC1 variation on neuroanatomical and neurocognitive phenotypes.
21471969 2011 DISC1-dependent switch from progenitor proliferation to migration in the developing cortex.
21445958 2011 DISC1 exon 11 rare variants found more commonly in schizoaffective spectrum cases than controls.
21376542 2011 The effects of DISC1 risk variants on brain activation in controls, patients with bipolar disorder and patients with schizophrenia.
21368031 2011 Disc1 point mutations in mice affect development of the cerebral cortex.
21358711 2011 Association of white matter integrity with genetic variation in an exonic DISC1 SNP.
21315744 2012 Mutant DISC1 affects methamphetamine-induced sensitization and conditioned place preference: a comorbidity model.
21298101 2011 DISC1 and Huntington's disease--overlapping pathways of vulnerability to neurological disorder?
21256178 2011 Association study between Disrupted-in-Schizophrenia-1 (DISC1) and Japanese patients with treatment-resistant schizophrenia (TRS).
21222298 2011 Limited association between Disrupted in Schizophrenia 1 (DISC1) gene and bipolar disorder in the Chinese population.
21149852 2011 DISC1 in schizophrenia: genetic mouse models and human genomic imaging.
21091867 2011 No association of Disrupted-in-Schizophrenia-1 variation with prefrontal function in patients with schizophrenia and bipolar disorder.
21079610 2011 Disrupted in Schizophrenia-1 regulates intracellular trafficking of mitochondria in neurons.
21041608 2011 Family-based analysis of genetic variation underlying psychosis-inducing effects of cannabis: sibling analysis and proband follow-up.
20956536 2010 CAMDI, a novel disrupted in schizophrenia 1 (DISC1)-binding protein, is required for radial migration.
20880836 2010 Disrupted-in-schizophrenia 1 (DISC1) plays essential roles in mitochondria in collaboration with Mitofilin.
20850505 2010 Identification of high risk DISC1 protein structural variants in patients with bipolar spectrum disorder.
20691427 2010 Genetic associations of brain structural networks in schizophrenia: a preliminary study.
20666147 2010 [Current perspective on the pathogenesis of schizophrenia from the viewpoint of risk factors such as DISC1 (corrected)].
20628343 2011 Common functional polymorphisms of DISC1 and cortical maturation in typically developing children and adolescents.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20574532 2010 Intermediate phenotypes identify divergent pathways to Alzheimer's disease.
20531939 2010 DISC1 regulates primary cilia that display specific dopamine receptors.
20531374 2011 Association of Disrupted in Schizophrenia 1 (DISC1) missense variants with ultra-resistant schizophrenia.
20505556 2010 Association of DISC1 gene with schizophrenia in families from two distinct French and Algerian populations.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20360304 2010 The DISC1 Ser704Cys substitution affects centrosomal localization of its binding partner PCM1 in glia in human brain.
20351714 2011 Poor replication of candidate genes for major depressive disorder using genome-wide association data.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
20227423 2010 A functional polymorphism in the disrupted-in schizophrenia 1 gene is associated with chronic fatigue syndrome.
20212127 2010 Disrupted-in-Schizophrenia-1 expression is regulated by beta-site amyloid precursor protein cleaving enzyme-1-neuregulin cascade.
20168324 2010 Variation in DISC1 is associated with anxiety, depression and emotional stability in elderly women.
20084519 2010 Evidence of statistical epistasis between DISC1, CIT and NDEL1 impacting risk for schizophrenia: biological validation with functional neuroimaging.
20048751 2011 Differential effects of prenatal and postnatal expressions of mutant human DISC1 on neurobehavioral phenotypes in transgenic mice: evidence for neurodevelopmental origin of major psychiatric disorders.
19944766 2010 A pilot multivariate parallel ICA study to investigate differential linkage between neural networks and genetic profiles in schizophrenia.
19913623 2010 Additive effect of NRG1 and DISC1 genes on lateral ventricle enlargement in first episode schizophrenia.
19805229 2009 DISC1 splice variants are upregulated in schizophrenia and associated with risk polymorphisms.
19782967 2009 Mixture model clustering of phenotype features reveals evidence for association of DTNBP1 to a specific subtype of schizophrenia.
19693267 2009 Financial and psychological risk attitudes associated with two single nucleotide polymorphisms in the nicotine receptor (CHRNA4) gene.
19632097 2009 Genetic association and post-mortem brain mRNA analysis of DISC1 and related genes in schizophrenia.
19586833 2009 Construction of balanced translocation t(1;11)(q42.1;q14.3) probe and screening application in genomic samples in Taiwan.
19583211 2009 Oligomer assembly of the C-terminal DISC1 domain (640-854) is controlled by self-association motifs and disease-associated polymorphism S704C.
19548263 2010 A population-based association study of candidate genes for depression and sleep disturbance.
19502360 2009 Disc1 regulates granule cell migration in the developing hippocampus.
19455170 2009 DISC-1 Leu607Phe alleles differentially affect centrosomal PCM1 localization and neurotransmitter release.
19451621 2009 Reduced expression of the Kinesin-Associated Protein 3 (KIFAP3) gene increases survival in sporadic amyotrophic lateral sclerosis.
19414483 2009 The DISC locus and schizophrenia: evidence from an association study in a central European sample and from a meta-analysis across different European populations.
19367581 2010 Identification of neuroglycan C and interacting partners as potential susceptibility genes for schizophrenia in a Southern Chinese population.
19352214 2009 Association study of DISC1 in Korean population with autism spectrum disorders.
19328558 2009 Case-control association study of 65 candidate genes revealed a possible association of a SNP of HTR5A to be a factor susceptible to bipolar disease in Bulgarian population.
19304459 2009 The Disrupted-in-Schizophrenia-1 Ser704Cys polymorphism and brain morphology in schizophrenia.
19303846 2009 Disrupted in schizophrenia 1 regulates neuronal progenitor proliferation via modulation of GSK3beta/beta-catenin signaling.
19300510 2009 The DISC1 pathway modulates expression of neurodevelopmental, synaptogenic and sensory perception genes.
19255581 2010 Association of DISC1 and TSNAX genes and affective disorders in the depression case-control (DeCC) and bipolar affective case-control (BACCS) studies.
19251251 2009 Association between genes of Disrupted in schizophrenia 1 (DISC1) interactors and schizophrenia supports the role of the DISC1 pathway in the etiology of major mental illnesses.
19191256 2009 Association studies and gene expression analyses of the DISC1-interacting molecules, pericentrin 2 (PCNT2) and DISC1-binding zinc finger protein (DBZ), with schizophrenia and with bipolar disorder.
19188535 2009 Association of variants in DISC1 with psychosis-related traits in a large population cohort.
19118814 2009 Genome-wide association study implicates a chromosome 12 risk locus for late-onset Alzheimer disease.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19077115 2009 Replication study of candidate genes for cognitive abilities: the Lothian Birth Cohort 1936.
19046394 2008 Association of the SerCys DISC1 polymorphism with human hippocampal formation gray matter and function during memory encoding.
18983980 2008 DISC1, PDE4B, and NDE1 at the centrosome and synapse.
18955030 2008 DISC1-kendrin interaction is involved in centrosomal microtubule network formation.
18818052 2008 Association between a disrupted-in-schizophrenia 1 (DISC1) single nucleotide polymorphism and schizophrenia in a combined Scandinavian case-control sample.
18800054 2008 Effect of disrupted-in-schizophrenia-1 on pre-frontal cortical function.
18762586 2008 Recruitment of PCM1 to the centrosome by the cooperative action of DISC1 and BBS4: a candidate for psychiatric illnesses.
18620078 2008 Immunohistochemical analysis of Disc1 expression in the developing and adult hippocampus.
18583979 2008 Systematic meta-analyses and field synopsis of genetic association studies in schizophrenia: the SzGene database.
18497105 2008 What can we learn from the disrupted in schizophrenia 1 interactome: lessons for target identification and disease biology?
18474207 2008 Disrupted-in-Schizophrenia-1.
18469341 2008 Elucidating the relationship between DISC1, NDEL1 and NDE1 and the risk for schizophrenia: evidence of epistasis and competitive binding.
18400883 2008 Insolubility of disrupted-in-schizophrenia 1 disrupts oligomer-dependent interactions with nuclear distribution element 1 and is associated with sporadic mental disease.
18395819 2009 No pathogenic rearrangement within the DISC 1 gene in psychosis.
18317464 2009 DISC1 association, heterogeneity and interplay in schizophrenia and bipolar disorder.
18270998 2008 DISC1 mRNA expression is not influenced by common Cis-acting regulatory polymorphisms or imprinting.
18198266 2008 No significant association of 14 candidate genes with schizophrenia in a large European ancestry sample: implications for psychiatric genetics.
18180429 2008 Family-based association study of lithium-related and other candidate genes in bipolar disorder.
18164685 2008 Identification of high risk DISC1 structural variants with a 2% attributable risk for schizophrenia.
18078707 2008 DISC1 is associated with prefrontal cortical gray matter and positive symptoms in schizophrenia.
18075479 2007 Lack of association between polymorphisms in the 5' upstream region of the DISC1 gene and mood disorders.
17997036 2008 Association study of polymorphisms between DISC1 and schizophrenia in a Korean population.
17912248 2008 The DISC locus in psychiatric illness.
17823207 2007 Disrupted in schizophrenia 1 and phosphodiesterase 4B: towards an understanding of psychiatric illness.
17673452 2007 Association of distinct allelic haplotypes of DISC1 with psychotic and bipolar spectrum disorders and with underlying cognitive impairments.
17579608 2008 Association of DISC1 with autism and Asperger syndrome.
17286247 2007 Positive association of the Disrupted-in-Schizophrenia-1 gene (DISC1) with schizophrenia in the Chinese Han population.
17185386 2007 Families with the risk allele of DISC1 reveal a link between schizophrenia and another component of the same molecular pathway, NDE1.
17117617 2006 Functional genomics in postmortem human brain: abnormalities in a DISC1 molecular pathway in schizophrenia.
17055463 2007 Significant support for DAO as a schizophrenia susceptibility locus: examination of five genes putatively associated with schizophrenia.
17043677 2007 Disrupted in Schizophrenia 1 Interactome: evidence for the close connectivity of risk genes and a potential synaptic basis for schizophrenia.
17035248 2006 DISC1-NDEL1/NUDEL protein interaction, an essential component for neurite outgrowth, is modulated by genetic variations of DISC1.
17006672 2007 Evidence for statistical epistasis between catechol-O-methyltransferase (COMT) and polymorphisms in RGS4, G72 (DAOA), GRM3, and DISC1: influence on risk of schizophrenia.
16997000 2006 A single nucleotide polymorphism fine mapping study of chromosome 1q42.1 reveals the vulnerability genes for schizophrenia, GNPAT and DISC1: Association with impairment of sustained attention.
16959794 2006 Impact of the DISC1 Ser704Cys polymorphism on risk for major depression, brain morphology and ERK signaling.
16936759 2006 Evidence that a DISC1 frame-shift deletion associated with psychosis in a single family may not be a pathogenic mutation.
16936715 2007 The FEZ1 gene shows no association to schizophrenia in Caucasian or African American populations.
16843095 2006 The genetics and biology of DISC1--an emerging role in psychosis and cognition.
16814263 2006 Differential expression of disrupted-in-schizophrenia (DISC1) in bipolar disorder.
16736468 2006 DISC1 immunoreactivity at the light and ultrastructural level in the human neocortex.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16524593 2007 Case-control association study of Disrupted-in-Schizophrenia-1 (DISC1) gene and schizophrenia in the Chinese population.
16510495 2006 Expression of DISC1 binding partners is reduced in schizophrenia and associated with DISC1 SNPs.
16389590 2006 Genetic association between schizophrenia and the DISC1 gene in the Scottish population.
16293762 2005 DISC1 and PDE4B are interacting genetic factors in schizophrenia that regulate cAMP signaling.
16275808 2005 Association of DISC1/TRAX haplotypes with schizophrenia, reduced prefrontal gray matter, and impaired short- and long-term memory.
16243297 2005 A functional link between Disrupted-In-Schizophrenia 1 and the eukaryotic translation initiation factor 3.
16209927 2005 Disrupted in schizophrenia 1 (DISC1): subcellular targeting and induction of ring mitochondria.
16103888 2005 A haplotype within the DISC1 gene is associated with visual memory functions in families with a high density of schizophrenia.
16056147 2005 DISC1 and neurocognitive function in schizophrenia.
16054297 2005 Association between genotype at an exonic SNP in DISC1 and normal cognitive aging.
16039834 2005 Association study of the DISC1/TRAX locus with schizophrenia in a Japanese population.
15940305 2005 A frameshift mutation in Disrupted in Schizophrenia 1 in an American family with schizophrenia and schizoaffective disorder.
15939883 2005 Variation in DISC1 affects hippocampal structure and function and increases risk for schizophrenia.
15838535 2005 Association between the TRAX/DISC locus and both bipolar disorder and schizophrenia in the Scottish population.
15797709 2005 Subcellular targeting of DISC1 is dependent on a domain independent from the Nudel binding site.
15728732 2005 Inhibition of NUDEL (nuclear distribution element-like)-oligopeptidase activity by disrupted-in-schizophrenia 1.
15657124 2005 A form of DISC1 enriched in nucleus: altered subcellular distribution in orbitofrontal cortex in psychosis and substance/alcohol abuse.
15478311 2004 DISC1 and DISC2: discovering and dissecting molecular mechanisms underlying psychiatric illness.
15386212 2004 Disrupted in schizophrenia 1 (DISC1): association with schizophrenia, schizoaffective disorder, and bipolar disorder.
15342131 2004 Association study of polymorphisms in the 5' upstream region of human DISC1 gene with schizophrenia.
15184103 2004 Clinical phenotypes associated with DISC1, a candidate gene for schizophrenia.
15121183 2004 Disrupted in Schizophrenia 1 (DISC1) is a multicompartmentalized protein that predominantly localizes to mitochondria.
15094396 2004 DISC1 localizes to the centrosome by binding to kendrin.
14962739 2004 Disrupted in Schizophrenia 1 and Nudel form a neurodevelopmentally regulated protein complex: implications for schizophrenia and other major neurological disorders.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14623284 2003 Yeast two-hybrid screens implicate DISC1 in brain development and function.
14532331 2003 Haplotype transmission analysis provides evidence of association for DISC1 to schizophrenia and suggests sex-dependent effects.
12874605 2003 Disrupted-In-Schizophrenia 1, a candidate gene for schizophrenia, participates in neurite outgrowth.
12812986 2003 DISC1 (Disrupted-In-Schizophrenia 1) is a centrosome-associated protein that interacts with MAP1A, MIPT3, ATF4/5 and NUDEL: regulation and loss of interaction with mutation.
12573262 2003 Evolutionary constraints on the Disrupted in Schizophrenia locus.
12506198 2003 Disrupted-in-Schizophrenia-1 (DISC-1): mutant truncation prevents binding to NudE-like (NUDEL) and inhibits neurite outgrowth.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11468279 2001 Chromosome 1 loci in Finnish schizophrenia families.
11443544 2001 Schizophrenia and affective disorders--cosegregation with a translocation at chromosome 1q42 that directly disrupts brain-expressed genes: clinical and P300 findings in a family.
10945471 2000 Chromosomal location and genomic structure of the human translin-associated factor X gene (TRAX; TSNAX) revealed by intergenic splicing to DISC1, a gene disrupted by a translocation segregating with schizophrenia.
10814723 2000 Disruption of two novel genes by a translocation co-segregating with schizophrenia.
9455484 1997 Characterization of cDNA clones in size-fractionated cDNA libraries from human brain.