Property Summary

NCBI Gene PubMed Count 8
PubMed Score 35.44
PubTator Score 49.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Renal Cell Carcinoma 199
Disease Target Count P-value
ovarian cancer 8491 1.0e-04
tuberculosis 1563 2.2e-04
active ulcerative colitis 477 1.3e-02
spina bifida 1064 3.0e-02
Disease Target Count Z-score Confidence
Seminal vesicle tumor 3 4.066 2.0
Disease Target Count
Renal Cell Carcinoma, Nonpapillary 7

Expression

  Differential Expression (4)

Disease log2 FC p
tuberculosis -1.300 2.2e-04
active ulcerative colitis 1.174 1.3e-02
spina bifida -1.896 3.0e-02
ovarian cancer 1.300 1.0e-04

Gene RIF (2)

PMID Text
21692750 Data strongly support the idea that DIRC2 is an electrogenic lysosomal metabolite transporter which is subjected to and presumably modulated by limited proteolytic processing.
11912179 Gene disruption may result in haplo-insufficiency and, through this mechanism, in the onset of tumor growth.

AA Sequence

MGSRWSSEEERQPLLGPGLGPGLGASWRSREAAAAALPAAVPGPGRVYGRRWLVLLLFSLLAFVQGLVWN      1 - 70
TWGPIQNSARQAYGFSSWDIALLVLWGPIGFLPCFAFMWLLDKRGLRITVLLTSFLMVLGTGLRCIPISD     71 - 140
LILKRRLIHGGQMLNGLAGPTVMNAAPFLSTTWFSADERATATAIASMLSYLGGACAFLVGPLVVPAPNG    141 - 210
TSPLLAAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQRLSYRRSVCRLLSNF    211 - 280
RFLMIALAYAIPLGVFAGWSGVLDLILTPAHVSQVDAGWIGFWSIVGGCVVGIAMARFADFIRGMLKLIL    281 - 350
LLLFSGATLSSTWFTLTCLNSITHLPLTTVTLYASCILLGVFLNSSVPIFFELFVETVYPVPEGITCGVV    351 - 420
TFLSNMFMGVLLFFLTFYHTELSWFNWCLPGSCLLSLLLILCFRESYDRLYLDVVVSV                421 - 478
//

Text Mined References (8)

PMID Year Title
21692750 2011 Disrupted in renal carcinoma 2 (DIRC2), a novel transporter of the lysosomal membrane, is proteolytically processed by cathepsin L.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12237231 2002 Molecular cytogenetic analysis of clustered sporadic and familial renal cell carcinoma-associated 3q13 approximately q22 breakpoints.
11912179 2002 Disruption of a novel MFS transporter gene, DIRC2, by a familial renal cell carcinoma-associated t(2;3)(q35;q21).