Property Summary

NCBI Gene PubMed Count 54
PubMed Score 81.74
PubTator Score 102.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (50)

AA Sequence

MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTI      1 - 70
ENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGN     71 - 140
NLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPE    141 - 210
KKSQMPNTTEKLLDKCIIM                                                       211 - 229
//

Text Mined References (54)

PMID Year Title