Property Summary

NCBI Gene PubMed Count 41
PubMed Score 98.03
PubTator Score 180.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma -1.100 1.5e-07
posterior fossa group A ependymoma 1.200 2.0e-03
psoriasis -1.700 3.5e-36

Gene RIF (34)

AA Sequence

MPRQATSRLVVGEGEGSQGASGPAATMLRSLLLHSLRLCAQTASCLVLFPRFLGTAFMLWLLDFLCIRKH      1 - 70
FLGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEV     71 - 140
VLPDGFQSQHILDYAQGNRPLVLNFGSCTUPPFMARMSAFQRLVTKYQRDVDFLIIYIEEAHPSDGWVTT    141 - 210
DSPYIIPQHRSLEDRVSAARVLQQGAPGCALVLDTMANSSSSAYGAYFERLYVIQSGTIMYQGGRGPDGY    211 - 280
QVSELRTWLERYDEQLHGARPRRV                                                  281 - 304
//

Text Mined References (42)

PMID Year Title