Property Summary

NCBI Gene PubMed Count 52
PubMed Score 144.34
PubTator Score 59.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -2.652 9.2e-03

Gene RIF (36)

PMID Text
26947333 All these results indicate that the oxidative stress downregulates the conversion of T4 to T3 through DIO1 function in HepG2 cells.
25304215 Thyroid hormone deiodinases D1, D2, and D3 are differentially expressed in endothelial cells following thyroid hormone exposure.
24878678 [review] Deiodinase type 1 polymorphisms particularly show moderate-to-strong relationships with thyroid hormone parameters, insulin-like growth factor (IGF)1 protein production, and risk for depression.
24162265 The pattern of expression and role of triiodothyronine (T3) receptors and type I 5'-deiodinase in breast carcinomas, benign breast diseases, lactational change, and normal breast epithelium.
23462647 a new mechanism of posttranscriptional regulation of DIO1 and show deregulation of DIO1 expression in pituitary adenoma, possibly resulting from disturbed expression of SF2/ASF.
22544951 Data indicate that type 1 deiodinase is subject to catalysis-induced loss of activity.
22339181 D1-C785T polymorphism correlates with the severity of pre-eclampsia
22207295 investigation of DIO1 and DIO2 activities in 66 thyroid tissue samples from follicular thyroid adenoma, toxic diffuse goiter, nontoxic multinodular goiter, papillary thyroid carcinoma, and surrounding normal tissues
22067325 Short interfering RNA-mediated knockdown of FOXA1 decreased the expression of DIO1 mRNA, but knockdown of both FOXA1 and FOXA2 restored it.
21912701 a novel miRNA-mediated regulatory mechanism of Type 1 iodothyronine deiodinase expression in clear cell Renal Cell Carcinoma
21563302 we report that SNP at the DIO1 variant rs11206244 is associated with lifetime major depression in White females in high-risk cohorts.
21415143 [review] aims at presenting an updated picture of the recent advances made in the biochemical and molecular properties of D1 as well as its role in human physiology
20049650 lower enzymatic activity in hemangiomas in relation to healthy liver tissue
19730683 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19190113 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19064291 A functional polymorphism in type 1 deiodinase is associated with enhanced potentiation of the antidepressant effect of sertraline by triiodothyronine
19064291 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18793344 The D1-C785T polymorphism is significantly associated with serum thyroid hormone levels.
18793344 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18492748 common genetic variation in DIO1 alters deiodinase function, resulting in an alteration in the balance of circulating free T(3) to free T(4).
18492748 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18426912 HNF4alpha regulates thyroid hormone homeostasis through transcriptional regulation of the Dio1 gene with GATA4 and KLF9
18349068 The role of type 1 and type 2 5'-deiodinase in the pathophysiology of the 3,5,3'-triiodothyronine toxicosis of McCune-Albright syndrome.
17274741 presence of type 1 5'-deiodinase in well-differentiated breast cancer tissue
17105838 Observational study of gene-disease association. (HuGE Navigator)
17105838 association of D1a-C/T and D1b-A/G polymorphisms with iodothyronine levels in the elderly
16131326 many factors interact in complex ways to establish D1 levels, contributing to the circulating concentrations of thyroxine (T(4)) and T(3) [review]
15785240 DIO1 and DIO2 were underexpressed in nearly all papillary thyroid carcinomas
15483075 Observational study of gene-disease association. (HuGE Navigator)
12847093 D1 contains a glycoside hydrolase clan GH-A-like structure
12586771 overexpressed iodothyronine deiodinase types 1,2, and 3 can homodimerize probably through disulfide bridges and types 1 and 2 monomeric forms are catalytically active
12153750 finding that normal pituitary tissue and pituitary adenomas expressed 5'-deiodinase activity implies that both enzymes are active in tumors and local deiodination is important for function and feedback regulation of anterior pituitary

AA Sequence

MGLPQPGLWLKRLWVLLEVAVHVVVGKVLLILFPDRVKRNILAMGEKTGMTRNPHFSHDNWIPTFFSTQY      1 - 70
FWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQRCNIWEFMQGNRPLVLNFGSCTUPSFMFKFDQFKRLI     71 - 140
EDFSSIADFLVIYIEEAHASDGWAFKNNMDIRNHQNLQDRLQAAHLLLARSPQCPVVVDTMQNQSSQLYA    141 - 210
ALPERLYIIQEGRILYKGKSGPWNYNPEEVRAVLEKLHS                                   211 - 249
//

Text Mined References (52)

PMID Year Title
26947333 2016 Type 1 5'-deiodinase activity is inhibited by oxidative stress and restored by alpha-lipoic acid in HepG2 cells.
25304215 2015 Thyroid hormone deiodinases D1, D2, and D3 are expressed in human endothelial dermal microvascular line: effects of thyroid hormones.
24878678 2014 Genetics in endocrinology: genetic variation in deiodinases: a systematic review of potential clinical effects in humans.
24162265 2014 The pattern of expression and role of triiodothyronine (T3) receptors and type I 5'-deiodinase in breast carcinomas, benign breast diseases, lactational change, and normal breast epithelium.
23502783 2013 The CCND1 c.870G>A polymorphism is a risk factor for t(11;14)(q13;q32) multiple myeloma.
23462647 2013 Alternative splicing of iodothyronine deiodinases in pituitary adenomas. Regulation by oncoprotein SF2/ASF.
23408906 2013 A meta-analysis of thyroid-related traits reveals novel loci and gender-specific differences in the regulation of thyroid function.
22544951 2012 Catalysis leads to posttranslational inactivation of the type 1 deiodinase and alters its conformation.
22339181 2012 The effect of the D1-C785T polymorphism in the type 1 iodothyronine deiodinase gene on the circulating thyroid hormone levels in Romanian women with preeclampsia. Association with the degree of severity and pregnancy outcome of preeclampsia.
22207295 2012 Positive correlation between type 1 and 2 iodothyronine deiodinases activities in human goiters.
22067325 2012 Forkhead box A1 (FOXA1) and A2 (FOXA2) oppositely regulate human type 1 iodothyronine deiodinase gene in liver.
21912701 2011 MiR-224 targets the 3'UTR of type 1 5'-iodothyronine deiodinase possibly contributing to tissue hypothyroidism in renal cancer.
21563302 2011 The relationship of deiodinase 1 genotype and thyroid function to lifetime history of major depression in three independent populations.
21415143 2011 Deiodinases: the balance of thyroid hormone: type 1 iodothyronine deiodinase in human physiology and disease.
20049650 2010 The enzymatic activity of type 1 iodothyronine deiodinase (D1) is low in liver hemangioma: a preliminary study.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19534619 2009 Disturbed expression of type 1 iodothyronine deiodinase splice variants in human renal cancer.
19190113 2009 Common variation in the DIO2 gene predicts baseline psychological well-being and response to combination thyroxine plus triiodothyronine therapy in hypothyroid patients.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19064291 2009 Preliminary evidence that a functional polymorphism in type 1 deiodinase is associated with enhanced potentiation of the antidepressant effect of sertraline by triiodothyronine.
18793344 2009 The effect of genetic variation in the type 1 deiodinase gene on the interindividual variation in serum thyroid hormone levels: an investigation in healthy Danish twins.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18492748 2008 A common variation in deiodinase 1 gene DIO1 is associated with the relative levels of free thyroxine and triiodothyronine.
18426912 2008 Hepatocyte nuclear factor 4alpha contributes to thyroid hormone homeostasis by cooperatively regulating the type 1 iodothyronine deiodinase gene with GATA4 and Kruppel-like transcription factor 9.
18349068 2008 The role of type 1 and type 2 5'-deiodinase in the pathophysiology of the 3,5,3'-triiodothyronine toxicosis of McCune-Albright syndrome.
17274741 2007 Human breast cancer tissue expresses high level of type 1 5'-deiodinase.
17105838 2007 The association of polymorphisms in the type 1 and 2 deiodinase genes with circulating thyroid hormone parameters and atrophy of the medial temporal lobe.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16131326 2005 Regulation of type 1 iodothyronine deiodinase in health and disease.
15785240 2005 Gene expression profiles reveal that DCN, DIO1, and DIO2 are underexpressed in benign and malignant thyroid tumors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15483075 2005 A polymorphism in type I deiodinase is associated with circulating free insulin-like growth factor I levels and body composition in humans.
15028279 2004 PCR isolation and cloning of novel splice variant mRNAs from known drug target genes.
12847093 2003 The iodothyronine selenodeiodinases are thioredoxin-fold family proteins containing a glycoside hydrolase clan GH-A-like structure.
12775843 2003 Characterization of mammalian selenoproteomes.
12586771 2003 In vivo dimerization of types 1, 2, and 3 iodothyronine selenodeiodinases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12153750 2002 Expression of 5'-deiodinase enzymes in normal pituitaries and in various human pituitary adenomas.
11383912 2001 Type I 5'-iodothyronine deiodinase activity and mRNA are remarkably reduced in renal clear cell carcinoma.
9784399 1998 Quantitative measurements for type 1 deiodinase messenger ribonucleic acid in human peripheral blood mononuclear cells: mechanism of the preferential increase of T3 in hyperthyroid Graves' disease.
9249039 1997 The promoter of the human type I 5'-deiodinase gene--mapping of the transcription start site and identification of a DR+4 thyroid-hormone-responsive element.
9192862 1997 Structure of the human type I iodothyronine 5'-deiodinase gene and localization to chromosome 1p32-p33.
8964838 1996 The structure of the coding and 5'-flanking region of the type 1 iodothyronine deiodinase (dio1) gene is normal in a patient with suspected congenital dio1 deficiency.
8473826 1993 The role of thyroidal type-I iodothyronine deiodinase in tri-iodothyronine production by human and sheep thyrocytes in primary culture.
8427198 1993 Molecular cloning of the selenocysteine-containing enzyme type I iodothyronine deiodinase.
8187873 1994 Activation and inactivation of thyroid hormone by type I iodothyronine deiodinase.
8033262 1994 Role of sulfation in thyroid hormone metabolism.
7744884 1995 Topological analysis of the integral membrane protein, type 1 iodothyronine deiodinase (D1).
7651427 1995 A novel retinoid X receptor-independent thyroid hormone response element is present in the human type 1 deiodinase gene.
1400883 1992 Cloning and in vitro expression of the human selenoprotein, type I iodothyronine deiodinase.