Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.95
PubTator Score 2.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.174 2.1e-02
Multiple myeloma 1.773 9.6e-05
osteosarcoma -1.045 3.0e-03
non primary Sjogren syndrome sicca 1.400 1.4e-02

Gene RIF (3)

PMID Text
25851604 DIMT1L and WBSCR22-TRMT112 are required for distinct pre-rRNA processing reactions leading to synthesis of 18S rRNA. Ribosome biogenesis requires the presence of the modification enzyme rather than its RNA-modifying catalytic activity.
25187177 Epigenetic silencing of miR-210 increases the proliferation of gastric epithelium during chronic Helicobacter pylori infection by activating STMN1 and DIMT1.
18187620 Knockdown of DIM1 dimethyladenosine transferase 1 homolog (DIMT1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MPKVKSGAIGRRRGRQEQRRELKSAGGLMFNTGIGQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNM      1 - 70
TVKLLEKAKKVVACELDPRLVAELHKRVQGTPVASKLQVLVGDVLKTDLPFFDTCVANLPYQISSPFVFK     71 - 140
LLLHRPFFRCAILMFQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIE    141 - 210
PKNPPPPINFQEWDGLVRITFVRKNKTLSAAFKSSAVQQLLEKNYRIHCSVHNIIIPEDFSIADKIQQIL    211 - 280
TSTGFSDKRARSMDIDDFIRLLHGFNAEGIHFS                                         281 - 313
//

Text Mined References (12)

PMID Year Title
25851604 2015 The human 18S rRNA base methyltransferases DIMT1L and WBSCR22-TRMT112 but not rRNA modification are required for ribosome biogenesis.
25187177 2014 Epigenetic silencing of miR-210 increases the proliferation of gastric epithelium during chronic Helicobacter pylori infection.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429849 2002 Functional proteomic analysis of human nucleolus.
11124703 2001 Characterization of 16 novel human genes showing high similarity to yeast sequences.
9584194 1998 Cell cycle-regulated processing of HEF1 to multiple protein forms differentially targeted to multiple subcellular compartments.