Property Summary

NCBI Gene PubMed Count 305
PubMed Score 1908.41
PubTator Score 696.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (31)

Disease log2 FC p
Rheumatoid Arthritis 2.000 4.7e-03
hepatocellular carcinoma -1.100 1.5e-05
Waldenstrons macroglobulinemia 1.234 3.2e-02
Multiple myeloma 1.048 4.0e-02
malignant mesothelioma 1.100 1.5e-05
astrocytic glioma 1.500 2.2e-02
permanent atrial fibrillation -1.200 1.0e-02
psoriasis -2.200 1.6e-05
osteosarcoma 2.264 1.8e-08
atypical teratoid / rhabdoid tumor 1.700 1.8e-04
glioblastoma 1.200 1.0e-03
medulloblastoma 1.100 2.2e-02
medulloblastoma, large-cell 1.400 1.7e-03
primitive neuroectodermal tumor 1.700 5.2e-03
Crohn's disease -1.726 5.6e-03
ulcerative colitis -2.242 6.8e-03
hereditary spastic paraplegia -1.301 1.4e-02
juvenile dermatomyositis 1.146 1.0e-05
Amyotrophic Lateral Sclerosis 1.398 1.9e-04
acute quadriplegic myopathy 1.040 2.0e-02
adrenocortical carcinoma 1.304 5.8e-04
tuberculosis and treatment for 6 months 2.000 7.4e-05
intraductal papillary-mucinous adenoma (... 1.200 3.8e-02
sarcoidosis 1.600 3.6e-03
Alzheimer's disease 1.200 2.7e-02
Pick disease 1.800 5.4e-06
progressive supranuclear palsy -1.100 9.1e-03
Breast cancer -1.300 5.2e-18
ovarian cancer 1.400 1.0e-04
Gaucher disease type 1 -1.800 3.3e-02
dermatomyositis 2.300 1.3e-04

Protein-protein Interaction (11)

Gene RIF (266)

PMID Text
27264823 Polymorphisms of rs3742330 of the DICER gene, particularly the AA genotype, may be associated with azoospermia.
26976605 An essential role of Dicer in microRNA biogenesis
26965998 this study proposes that inflammation-induced Jak-STAT3 signaling leads to colon cancer development through proteasomal degradation of DICER1 by ubiquitin ligase complex of CUL4A(DCAF1), which suggests a novel therapeutic opportunity for colon cancer
26943961 This work identifies Dicer regulation as both a potential mediator of MS pathology and a therapeutic target.
26921501 we found that both the structural features of shmiR hairpins and the nucleotide sequence at Drosha and Dicer processing sites contribute to cleavage site selection and cleavage precision.
26858029 the expression of MYCN, HMGA2, and DICER1 seems to be correlated to each other and the expression of the let7-genes impacted by their expression.
26837267 Dicer promotes endothelial maladaptation and atherosclerosis in part by miR-103-mediated suppression of KLF4.
26772403 our results emphasize the high prevalence of DICER1 mutations in pediatric cystic nephromas
26748703 essential function of Dicer in resolving the spontaneous DNA damage that occurs during the rapid proliferation of developmental progenitors and malignant cells.
26632874 Expression of DICER1 and microRNA are reduced in post-traumatic stress disorder with comorbid depression.
26621737 overexpression of this mutant Dicer, but not wild-type Dicer, also resulted in a partial inhibition of Influenza A virus-but not poliovirus-replication in human cells
26577641 report a DICER1 syndrome family with a medical history of different rare tumors mostly occurring at a young age
26555935 germline DICER1 mutations are associated with an increased risk of developing familial differentiated thyroid carcinoma
26513514 the microdeletion included the DICER1 gene. Mutations of DICER1 has been associated with an increased risk for pleuropulmonary blastoma (PPB)
26428316 Our results suggest that DICER1 mutations may not have a role in testicular sex cord-stromal tumorigenesis
26408257 Data indicate an association between DICER1 hotspot mutations and altered expression of cell growth and development genes.
26289771 Two patients with ovarian Sertoli-Leydig cell tumors and a germline intronic mutation in DICER1 are reported
26227789 Results indicate the role of Drosha, Dicer and Ago2 proteins in the development of non-small cell lung carcinomas (NSCLC) and suggest that Dicer may be implicated in the progression of these tumors to advanced stages.
26166215 the results showed that Dicer protein ablation leads to increased cell invasion, higher levels of matrix metalloproteinase-2, and decreased levels of key miRNAs shown to inhibit invasion
26156018 DICER1 and DROSHA copy number variation may be an important mechanism of upregulation/downregulation of miRNAs in lung cancer
26147304 Variations in DICER1 rs3742330 of Korean patients are significantly associated with their risk of colorectal cancer.
26087193 A weak DICER1 protein expression was associated with reduced disease-free and overall survival and was a predictor of recurrence in adrenocortical carcinomas.
26076803 The decreased expression of Dicer may be potential underlying mechanism in pathogenesis of IDC.
26033159 Suggest recurrent DICER1 hotspot mutations in endometrial tumours impact on microRNA biogenesis.
25990244 DICER1 plays a novel role in neutrophil differentiation as well as in myeloid autophagy of acute myelocytic leukemia cells.
25978641 These studies identify FGF9 as a target of DICER1 in lung epithelium that functions as an initiating factor for pleuropulmonary blastoma.
25977444 The polymorphic terminal-loop of pre-miR-1307 binding with MBNL1 contributes to colorectal carcinogenesis via interference with Dicer1 recruitment.
25944670 When platelets from healthy individuals were incubated with Ca2+ to activate the Ca2+-sensing receptor, the autolytic cleavage of calpain 1 occurred together with a slight but distinct shift in the mobility of Dicer in SDS-PAGE.
25911188 Dicer splicing isoform (found in neuroblastoma cells) lacks 1 exon and encodes a putative truncated protein, t-Dicer, lacking the dsRNA-binding domain and bearing altered 1 of 2 RNase III catalytic centers. t-Dicer preserved partial dicing activity.
25896246 MicroRNA expression profiling of skin and wound-edge tissue revealed global upregulation of miRNAs following wound closure at day 14 post-wounding with significant induction of Dicer expression
25883138 This review summarizes the current knowledge of factors that regulate Dicer gene transcription, primary transcript processing, mRNA translation and enzyme activity.
25867481 The sequence and structural features of Drosha and Dicer cleavage sites.
25752336 Data indicate a direct correlation between the protein kinase C alpha (PKC-alpha) and ribonuclease III Dicer.
25702703 Data show that increased p53, together with deceased cyclin D1 and endoribonuclease DICER1 in mammospheres were responsible for microRNA let-7 inhibition.
25656609 EIF2C2, Dicer, and Drosha are more highly expressed in bladder carcinoma, promote the development of bladder cancer, and suggested a poor prognosis
25640338 The present meta-analysis suggests that the C allele of the DICER rs1057035 polymorphism probably decreases cancer risk. However, this association may be Asian-specific.
25557550 Results show the crystal structure of the interface between microRNA biogenesis proteins Dicer and TRBP. Mutations in this interface prevent recruitment of TRBP to Dicer.
25526195 None of the observed variants appeared to be disease-related, suggesting that germline mutations in DICER1 are rare or absent in familial breast cancer patients.
25500911 define precise temporal and epithelial cell type-specific DICER1 functions in the developing lung and demonstrate that loss of these DICER1 functions is sufficient for the development of cystic pleuropulmonary blastoma
25480859 Dicer expression is decreased and is mechanistically linked to increased expression of co-stimulatory molecule CD80 in B cells of patients with multiple sclerosis
25457613 These findings indicate that miRNA depletion in dicer deficiency is due to the combined loss of miRNA-generating activity and catabolic function of TN/TX.
25456905 Dysregulation of Dicer and possibly altered expression of miRNAs are associated with aggressive features in thyroid cancers.
25439752 We aimed to evaluate the expression of the major components of microRNA biogenesis machinery including Drosha, Dicer and DiGeorge syndrome critical region gene 8 (DGCR8) in multiple sclerosis patients
25428210 We show that reduction of DICER1 in human female cells increases XIST transcripts without compromising the binding of the XIST and histone tail modifications on the Xi chromosome.
25416952 Report of transcriptome-wide map of Dicer targets; identify thousands of Dicer-binding sites in human cells and C. elegans; find known and hundreds of additional miRNAs; also report structural RNAs, promoter RNAs, and mitochondrial transcripts as Dicer targets; most Dicer-binding sites reside on mRNAs/lncRNAs and are not significantly processed into small RNAs.
25361944 Down-regulation of Dicer1 promotes cellular senescence and decreases the differentiation and stem cell-supporting capacities of mesenchymal stromal cells in patients with myelodysplastic syndrome.
25351418 DICER expression is suppressed by hypoxia through an epigenetic mechanism.
25349431 DICER1/Alu RNA dysmetabolism induces Caspase-8-mediated cell death in age-related macular degeneration.
25295740 Dicer is upregulated in gestational diabetes.
25195038 The aim of this study was to detect the expression levels of Dicer1, Drosha, DGCR8, and Ago2 messenger ribonucleic acids (mRNAs) in patients with primary gastrointestinal diffuse large B-cell lymphoma
25190313 DICER1 RNase IIIB mutations preferentially impair processing of miRNAs deriving from the 5'-arm of pre-miRNA hairpins in Wilms tumors.
25176334 Both germline and somatic mutations in DICER1 are implicated in diverse types of cancer. [Review]
25135428 High Dicer expression levels were associated with prostate cancer.
25123850 expression in laryngeal squamous cell carcinoma associated with survival
25118636 Pathogenic germline and somatic mutations of DICER1 in Nasal chondromesenchymal hamartoma (NCMH) establishes that the genetic etiology of NCMH is similar to pleuropulmonary blastoma (PPB), despite the disparate biological potential of these neoplasms.
25115815 Results show that the expression levels of Dicer1e influence the pathogenesis of oral cancer cells.
25061173 High Dicer1 expression is associated with resistance to bortezomib therapy in myeloma.
25035295 Importance of a weak G-U or U-G base pair at the top of the shRNA hairpin stem to hinder Dicer recognition.
25031339 Epstein-Barr virus EBNA1 protein regulates viral latency through effects on let-7 microRNA and dicer.
25022261 This study suggests that germ-line DICER1 mutations make a clinically significant contribution to pineoblastoma.
25010285 Knockdown of Dicer by shRNA leads to inhibit enrichment of HIV-1 Gag in intracellular vacuoles, but enhance viral particle release in Gag expressing cells
24987961 Discovery of a dicer-independent, cell-type dependent alternate targeting sequence generator: implications in gene silencing & pooled RNAi screens.
24938790 Knockdown of Dicer by shRNA leads to inhibit enrichment of HIV-1 Gag in intracellular vacuoles, but enhance viral particle release in Gag expressing cells
24913918 miR-581 promotes hepatitis B virus surface antigen expression by targeting Dicer and EDEM1 in HepG2 cells.
24909177 Data indicate that in addition to frequent biallelic loss of TP53 protein, each case had compound disruption of DICER1 protein.
24846461 Temporal separation of pro- and anti-apoptotic signaling induced by inhibition of Dicer1 is synergistic and synthetic lethal to low-dose 5-FU chemotherapy in p53-mutated HACAT cells.
24839956 findings show germ-line DICER1 mutations are a major contributor to pituitary blastoma (PitB); second somatic DICER1 "hits" occurring within the RNase IIIb domain also appear to be critical in PitB pathogenesis
24821309 DICER1 germline mutation is associated with pleuropulmonary blastoma.
24817967 Dysregulation of microRNA biosynthesis enzyme Dicer plays an important role in gastric cancer progression.
24814348 Dicer restricts dsRNA accumulation in nuclei.
24787017 Dicer expression regulated by miR-130a is an important potential prognostic factor in cervical cancer.
24769857 Association between recurrent pregnancy loss development and the polymorphism of the miRNA machinery gene RAN and combined genotype of DROSHA/DICER.
24725360 The altered expression of Dicer and Drosha may serve as markers for disrupted miRNA biogenesis in Triple negative breast cancer
24676997 Down-regulation of Dicer expression is associated with cervical cancer.
24676357 Mutations affecting the metal binding sites of the DICER1 RNase IIIb domain alter the balance of 3p and 5p microRNAs leading to deregulation of these growth signalling pathways, causing a novel human overgrowth syndrome.
24675358 Results highlight the role of RNase IIIb domain mutations in DICER1 along with TP53 inactivation in PPB pathogenesis.
24668803 Data indicate that cigarette smoke decreases RNA endonuclease DICER protein levels in exposed cells.
24617712 This report of somatic DICER1 mutations in differentiated thyroid carcinoma (DTC) strengthens the association between DTC and the DICER1 syndrome.
24574065 Low Dicer expression is associated with invasive breast carcinoma.
24486018 analysis of the structure of the Dicer phosphate-binding pocket within the platform-PAZ-connector helix cassette
24481001 The genetic analyses confirm that DICER1 mutations are the major genetic event in the development of cystic nephroma. Further, cystic nephroma and pleuropulmonary blastoma have similar DICER1 loss of function and 'hotspot' missense mutation rates
24462910 gDicer is required for follicle development, and structural differences in the helicase domain of two gDicer isoforms might contribute to their different roles in controlling granulosa cell apoptosis.
24386264 Deregulated Dicer expression is associated with aggressive tumour characteristics and is an independent prognostic factor for OS.
24337369 Taken together, the present study contributes important new findings for the role of Dicer-mediated miRNA processing in collagen synthesis of hepatic stellate cells , which may serve as a foundation for RNAi study of liver fibrosis in vivo.
24324261 The Hippo pathway effectors TAZ/YAP regulate dicer expression and microRNA biogenesis through Let-7.
24317682 Dicer functions as an indirect tumor suppressor, as silencing Dicer expression makes cancer cells more malignant.
24287487 Induction of Dicer by cyclin D1 coordinates microRNA biogenesis in breast cancer.
24244599 Dicer expression exhibits a tissue-specific diurnal pattern that is lost during aging and in diabetes.
24223844 Data suggest that miR-192 might be a key player in neuroblastoma (NB) by regulating Dicer1 expression.
24220032 a clear relationship between mutant p53, TAp63, and Dicer that might contribute to the metastatic function of mutant p53 but, interestingly, also reveal TAp63-independent functions of mutant p53 in controlling Dicer activity.
24204924 These specific inhibitors can simultaneously bind both Dicer and pre-miRNAs.
24163352 Deletion or depletion of Dicer in mouse or human activated CD8+ T cells causes up-regulation of perforin, granzymes, and effector cytokines.
24136150 More than half (8/15) of Sertoli-Leydig cell tumours (SLCTs) harbour DICER1 mutations in the RNase IIIb domain, while mutations are rarely found in germ cell tumors.
24096488 DICER1-deficient colorectal cancer cells have an enhanced ability to initiate tumors and metastasis.
24094887 Data show that the knockdown of Dicer significantly promoted cell proliferation, migration, and invasion.
24065110 We report here the first characterized exonic deletion in DICER1, which are responsible for a rare cancer syndrome, including tumors that can co-occur with multinodular goiter.
24025624 Authors establish HIV-1 tat and rev raginine rich motifs as a novel viral motifs evolved to target the Dicer dependent RNAi pathway.
24025624 Knockdown of Dicer by shRNA leads to inhibit enrichment of HIV-1 Gag in intracellular vacuoles, but enhance viral particle release in Gag expressing cells
23882114 we demonstrate that human Dicer has the ability to shuttle between the nucleus and the cytoplasm. We conclude that Dicer is a shuttling protein whose steady-state localization is cytoplasmic.
23868705 Polymorphism in DICER1 gene is associated with HBV-related hepatocellular carcinoma.
23868280 potentially fatal nature of pleuropulmonary blastoma argues that screening of DICER1 mutation carriers should be offered during the years of susceptibility
23851498 High Dicer expression is associated with prostate cancer growth and metastasis.
23849790 These results support a model in which Vpr complexes with human Dicer to boost its interaction with the CRL4(DCAF1) ubiquitin ligase complex and its subsequent degradation.
23849790 Knockdown of Dicer by shRNA leads to inhibit enrichment of HIV-1 Gag in intracellular vacuoles, but enhance viral particle release in Gag expressing cells
23763383 confirmed DICER1 hot-spot mutations in Sertoli-Leydig cell tumours (15.4%) in Korean patients.
23728841 Genetic testing revealed a novel heterozygous premature termination mutation (c.1525C>T p.R509X) in the DICER1 gene.
23663110 It is a miRNA processing enzyme and altered in non-alcoholic fatty liver disease.
23625684 The DICER1 gene encodes an enzyme that is involved in the biogenesis of microRNAs. The entire tumor spectrum and the respective tumor risks are unknown.
23624860 Dicer traps pre-siRNAs in a nonproductive conformation, whereas interactions of Dicer with pre-miRNAs and dsRNA-binding proteins induce structural changes in the enzyme that enable productive substrate recognition in the central catalytic channel.
23620094 Biallelic DICER1 mutations occur in Wilms tumours.
23550157 RISC proteins PACT, TRBP, and Dicer, together with PKR, are steroid receptor RNA activator-binding nuclear receptor coregulators that are recruited to the promoters of hormone-regulated genes and regulate the expression of downstream target genes.
23547758 germ-line or somatic DICER1 mutations do not haev a major role in the etiology of familial testicular germ cell tumours
23519840 Downregulation of DICER1 is associated with lymph node metastasis of gastric carcinoma.
23472152 Dicer is a direct target of miR-31, but also isomiRs display similar and disparate regulation of target genes in cell-based systems
23468895 Dicer can fine-tune the efficiency of SRP-mediated protein targeting via processing a proportion of 7SL RNA into fragments of different lengths.
23441612 homozygous CC genotype of DICER1, rs1057035, was significantly associated with decreased risk of colorectal cancer
23426981 DICER1 is upregulated by the hematopoietic transcription factor, GATA1, in acute myeloid leukemia.
23418872 The results suggest that DICER1 exons 25 and 26 mutations may be very rare in human hematopoietic tumors.
23392577 DICER1 is a miR-130b target gene in human endometrial cancer cells.DICER1 induced abnormal expression of the epithelial mesenchymal transition related genes.
23349018 Levels of DICER1, DROSHA and five different miRNAs were measured in NSCLC specimens.
23311378 Heat-induced regulation of Dicer expression occurs primarily post- transcriptionally, and the expression levels of Dicer protein are increased and often oscillate in response to fever-range hyperthermia in multiple mouse and human cells
23307239 Dicer1 was downregulated in nasopharyngeal carcinoma
23266047 Data indicate that tumour sample showed a significantly higher Drosha expression versus normal mucosa, while Dicer levels did not differ.
23251602 Dicer rs3742330 is associated with T cell lymphoma survival.
23222681 the molecular mechanisms by which loss of Dicer leads to DNA damage, as well as the role of Dicer in tumorigenesis.
23143396 Data show that the miRNA-processing enzyme, DICER and the main miRNA effector, AGO2, are targeted for degradation as miRNA-free entities
23141545 Results suggest that Dicer recognizes the loop/bulge structure in addition to the ends of shRNAs/pre-miRNAs for accurate processing.
23071822 rs1057035 in 3'UTR of DICER was associated with a significantly decreased risk of oral cancer
23068969 The G allele for IL-10 (-1082 A/G), the C allele for IL-4 (+3 C/T) and the C and T alleles for IL-28B (rs12979860 and rs8099917, respectively) are associated with spontaneous viral clearance in hepatitis C infection
23064648 DICER- and AGO3-dependent generation of retinoic acid-induced DR2 Alu RNAs regulates human stem cell proliferation.
23047949 The results define CLIMP-63 as a novel protein interactor and regulator of Dicer function, involved in maintaining Dicer protein levels in human cells.
22999255 Depletion of Dicer and TRBP, proteins involved in miRNA biogenesis, reduced HCV RNA accumulation, mature duplex miR-122 abundance, and miR-122 directed mRNA translation suppression, suggesting roles in miR-122 processing.
22984192 Dicer binding protects the terminal loop from digestion by S1 nuclease, suggesting that Dicer interacts directly with the terminal loop region.
22972926 Commitment to the T cell lineage requires transgenic Dicer expression in thymic epithelial cells.
22922797 MiR-3928 plays an important role in regulating the expression of Dicer.
22867905 study outlines a cancer syndrome caused by germline mutations in DICER1, responsible for microRNA processing; multiple endocrine manifestations of the DICER1 syndrome
22821364 Dicer protein plays a role in human breast cancer progression and behaviour.
22808238 Dicer can process 7SL RNA.
22766726 Dicer, Drosha, and Exportin 5 genes were up-regulated in bladder urothelial carcinoma compared to normal urothelium. Silencing these genes induced cell proliferation inhibition and apoptosis in bladder urothelial carcinoma cells.
22745131 functional deficiency of Dicer in chronic hypoxia is relevant to both HIF-alpha isoforms and hypoxia-responsive/HIF target genes, especially in the vascular endothelium.
22737231 expression of human Dicer in Dicer-null mouse embryonic fibroblasts restores their reprogramming potential, demonstrating that microRNAs are indispensable for dedifferentiation reprogramming
22727743 Distinct interactions of each Dicer domain with different RNA structural features.
22718634 The RNase activity of Dicer could be inhibited by substituting Ca 2 + for Mg 2 + .
22716222 Our data suggest that reduced Dicer expression might contribute to tumour progression in colorectal cancer
22689055 Knockdown of Sox4 induces a major change in the expression pattern of miRNAs in melanoma cells, mainly due to reduced expression of Dicer.
22647351 Drosha, Dicer, Argonaute 1, and Argonaute 2 are differentially expressed at different metastatic sites in ovarian carcinoma compared with primary carcinomas.
22615744 findings suggest loss of Dicer and failure of mature miRNA expression may be a feature of the pathophysiology of HS in patients with TLE
22546613 The results suggest that mutation of the clinically relevant residue D1709 in the RNase IIIB results in a uniquely miRNA-haploinsufficient state in which the let-7 family of tumor suppressor miRNAs is lost while a complement of 3p-derived miRNAs remains.
22541070 Findings present a novel self-recognition immune response, whereby endogenous Alu RNA-induced NLRP3 inflammasome activation results from DICER1 deficiency in a nonimmune cell, retinal pigmented epithelium and is implicated in georaphic atrophy.
22479364 Data show that down-regulation of either Dicer or Drosha had no effect on the sensitivity of cells to irradiation.
22446887 The effect of introducing transcription factors into two distinct colorectal cancer (CRC) cell lines, HCT116 and DLD-1, in the presence and absence of Dicer 1, ribonuclease type III (Dicer1), a critical miRNA processing enzyme, was studied.
22426548 Study describes a new domain localization strategy developed to determine the structure of human Dicer by electron microscopy.The helicase domains form a clamp-like structure adjacent to the RNase III active site, facilitating recognition of pre-miRNA loops or translocation on long dsRNAs.
22407237 study demonstrated that expression of miR-107 in gastric cancer tissues showed a significant negative association with DICER1 mRNA levels
22394132 results provide novel evidence that Dicer, is probably involved in the pathobiology of human smooth muscle neoplasms
22381205 The results showed that genetic variants of DICER1 may modify the risk of abnormal semen parameters, which could result in male infertility.
22371183 mesenchymal stromal cells from MDS patients show low gene and protein expression of DICER1 and DROSHA which are involved in the microRNA biogenesis, as well as their target gene SBDS.
22350415 miR-130a inhibited autophagy by reducing autophagosome formation, an effect mediated by downregulation of the genes ATG2B and DICER1.
22320315 Our data suggest that Dicer expression may play an important role in the progression and prognosis of CLL.
22310293 MiR-9 directly targets HuR and Dicer1 for posttranscriptional repression.
22252463 A novel effect of reduced DICER1 function in cancer cells, is reported.
22187960 Somatic missense mutations affecting the RNase IIIb domain of DICER1 are common in nonepithelial ovarian tumors.
22180160 Germline DICER1 mutations were found in all four patients with familial pleuropulmonary blastoma and 2 of 52 sporadic embryonal rhabdomyosarcoma had somatic mutations.
22179432 Dicer is significantly downregulated in transitional cell carcinomas compared to paired normal adjacent tissues samples and normal samples, suggesting that reduced expression of Dicer may play an important role in bladder cancer
22163034 AGO2, PACT and TRBP are required for the efficient functioning of Dicer in cells
22133720 The identification of neoplasia-associated germline mutations in DICER1 has focused translational research on components of the miRNA processing pathway.
22055188 MCPIP1 ribonuclease antagonizes dicer and terminates microRNA biogenesis through precursor microRNA degradation.
21953080 Drosha and Dicer expression was dysregulation in nasopharyngeal carcinoma compared with healthy control samples.
21937200 Data suggest Dicer expression as a possible molecular marker in patients with primary cutaneous T cell lymphomas and apparently indicate that miRNA(s) might be of clinical relevance in CTCL.
21898071 Low dicer expression is associated with breast cancer.
21889945 Data support the view that mutagens interfere with microRNA maturation by binding DICER.
21882293 We report DICER1 mutations in seven additional families that manifested uterine cervix embryonal rhabdomyosarcoma , primitive neuroectodermal tumor, Wilms tumor, pulmonary sequestration and juvenile intestinal polyp.
21878538 Dicer-overexpressing breast cancer cells enriched for cells with enhanced BCRP function.
21858095 Data suggest NUP153 plays a crucial role in the nuclear localization of the DICER1 protein.
21827717 Data show that in liver metastases, Dicer was positively related to miR-141.
21769619 Our results suggest that Drosha, Dicer, and Ago2 are possibly implicated in colorectal carcinoma pathobiology
21761362 microRNAs actively control some of the most distinguishing characteristics of the breast cancer subtypes, such as ERalpha itself, Dicer, and growth factor receptor levels
21753850 5'-end recognition by Dicer is important for precise and effective biogenesis of miRNAs
21698147 deregulation of Dicer and its influence on miRNA maturation is needed to predict the susceptibility of melanoma patients to miRNA-based therapy in the future
21559780 This study revealed for the first time that expression alterations of Dicer and Drosha are present in endometrial cancer tissue and could be potentially responsible for altered microRNAs profiles observed in this malignancy.
21501861 germline DICER1 mutations may be found in Pleuropulmonary blastoma-associated ovarian sex cord-stromal tumors (OSCST) cases.
21425145 Lower DICER1 transcript levels were correlated with disease recurrence and worse DFS survival in patients with endometrioid endometrial cancer.
21346072 Dicer1 helps regulate tubal expression of steroid hormone receptors in a cycle-dependent manner and may contribute to tubal transport in humans
21345667 Strong expression of the central microRNA biosynthesis enzyme Dicer predicts poor prognosis in patients with colorectal cancer
21306637 The two-step cleavage of a hairpin RNA with 5' overhangs shows that DICER releases double-stranded RNAs after the first cleavage and binds them again in the inverse direction for a second cleavage.
21297638 Exportin-5 controls Dicer1 expression post-transcriptionally.
21297615 findings reveal a miRNA-independent cell survival function for DICER1 involving retrotransposon transcript degradation
21266384 Haploinsufficiency of the Dicer1 gene is associated with a predisposition to a broad range of tumors.
21205968 DICER1 mutations are associated with both familial multinodular goiter (MNG) and MNG with Sertoli-Leydig cell tumor of the ovary, independent of pleuropulmonary blastoma
21160068 Dicer expression may play an important role in the progression and prognosis of monoclonal gammopathies
21048142 A transgenic mouse model with an inducible disruption of the Dicer1 gene in the adult forebrain shows microRNAs as key players in the learning and memory process of mammals.
21044367 Observational study of gene-disease association. (HuGE Navigator)
21036787 that DICER1 mutations are unlikely to have a major role in the aetiology of sporadic Wilms tumour.
21029372 miR-107, an oncogene miRNA promoting gastric cancer metastasis through down-regulation of DICER1.
20974746 Short RNA duplexes guide sequence-dependent cleavage by human dicer.
20962848 TAp63, a p53 family member, suppresses tumorigenesis and metastasis, and coordinately regulates Dicer and miR-130b to suppress metastasis
20932845 Dicer is much faster at processing a pre-miRNA substrate compared to a pre-siRNA substrate under both single and multiple turnover conditions
20869963 Results suggest that the interaction of Dicer with HTLV-I Rex inhibits Dicer activity and thereby reduces the efficiency of the conversion of shRNA to siRNA.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20805302 Findings of growth promotion by silencing Dicer implies its potential use as therapeutic targets for neuroblastoma.
20732906 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20730047 Dicer functions in maintaining integrity of rDNA arrays
20721975 Observational study of gene-disease association. (HuGE Navigator)
20615407 The identification of a novel splice variant of human dicer gene, the first one bearing a modified coding sequence, is identified.
20584909 Data show that HIV-1 suppresses the expression and function of DICER in macrophages, and that the presence of miRNAs in monocytes lacking DICER indicates that some miRNAs can be generated by proteins other than DICER.
20550935 Targeted knockout of DICER is lethal to melanocytes, at least partly via DICER-dependent processing of the pre-miRNA-17 approximately 92 cluster thus targeting BIM, a known proapoptotic regulator of melanocyte survival.
20530258 Dicer-dependent generation of microRNAs affects homeostasis and function of epidermal Langerhans cells.
20463238 loss of Dicer impairs Schwann cells (SCs)differentiation by disrupting the balance between stimulating and inhibiting pathways for the myelination process, suggest that SC-axon interactions are affected by SC-specific loss of miRNA-based gene regulation
20405249 reduced expression of Dicer may play an important role during the process of hepatocarcinogenesis.
20237275 Dicer is necessary for the developmental change in competence of the retinal progenitor cells.
20232482 examination of Dicer protein levels in four head and neck squamous cell carcinoma (HNSCC) cell lines demonstrated that Dicer had between 4- and 24-fold higher expression levels when compared to normal human primary gingival epithelial cells.
20211803 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20210522 Report dysregulation of microRNA processing enzymes Drosha and Dicer in epithelial skin tumors when compared to healthy control samples.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19914350 Upregulation of fibronectin-1 protects Dicer knockdown HEK293T cells against apoptosis.
19851984 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19836333 the three-dimensional structure of human Dicer bound to the protein TRBP at approximately 20 A resolution determined by negative-stain electron microscopy (EM) and single-particle analysis
19806572 The proliferation activity and invasive ability were significantly enhanced in cells transfected with Dicer siRNA.
19782670 Data show that Dicer mRNA expression is down-regulated in the majority of ovarian tumors when compared to normal tissues.
19678941 Hepatitis C virus (HCV) internal ribosome entry site (IRES) can be recognized and processed into small ribonucleic acid (RNA)s by human ribonuclease Dicer in vitro; domains II, III and VI of HCV IRES are potential in vitro substrates for Dicer.
19672267 Assessment of Dicer expression may facilitate prediction of distant metastases for patients suffering from breast cancer.
19646895 Loss of Dicer within ovarian granulosa cells, luteal tissue, oocyte, oviduct and, potentially, the uterus renders females infertile [review]
19556464 findings show that 11 multiplex pleuropulmonary blastoma families harbor heterozygous germline mutations in DICER1
19520829 Results show that Dicer is responsible for the generation of the mature miR-222 and -339, which suppress ICAM-1 expression on tumor cells.
19460752 Knockdown of dicer 1, ribonuclease type III (DICER1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19422693 Binding of Dicer to TRBPs is critical for RNAi function.
19393748 Dicer 1 gene is expressed in differentiating and terminally differentiated N-type cells.
19155329 Phosphorylation of FMRP regulates its association with the miRNA pathway by modulating association with Dicer.
19138993 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19127773 Data demonstrated a direct interaction between Dicer and Wig-1 and both may play a common role in dsRNA-related gene regulation.
19118902 Dicer is a stress response component and interferons are potentially important regulators of Dicer expression.
19092150 Our findings indicate that levels of Dicer and Drosha mRNA in ovarian-cancer cells have associations with outcomes in patients with ovarian cancer.
19082437 knockdown of Dicer inhibits human breast carcinoma cell growth
19047128 Observational study of gene-disease association. (HuGE Navigator)
19022417 Data delineated the smallest 5-lipoxygenase binding domain (5LObd) of Dicer to its C-terminal 140 amino acids comprising the double-stranded RNA (dsRNA) binding domain (dsRBD).
19017633 Dicer cleaved substrates containing short siRNA-like double-strand regions and extended 3' or 5' ssRNA overhangs in the adjacent ssRNA regions
18978195 Downregulation of Dicer expression by serum withdrawal sensitizes human endothelial cells to apoptosis.
18927112 Evidence that a Dicer helicase mutant is sensitive to the thermodynamic properties of the stems in microRNAs and short-hairpin RNAs, with thermodynamically unstable stems resulting in poor processing and a reduction in the levels of functional mi/siRNAs.
18700235 luciferase assay using a reporter carrying a putative target site in the 3' untranslated region of Dicer revealed that let-7 directly affects Dicer expression
18644891 Up-regulation of MICA and MICB is the result of DNA damage response activation caused by Dicer knockdown. RNAi is indirectly linked to the human innate immune system via the DNA damage pathway.
18637735 Chemical modifications patterns compatible with high potency dicer-substrate small interfering RNAs are reported.
18508075 These results suggest that the DExD/H-box domain likely disrupts the functionality of the Dicer active site until a structural rearrangement occurs, perhaps upon assembly with its molecular partners.
18413723 Intact DICER is required to maintain full promoter DNA hypermethylation of select epigenetically silenced loci in human cancer cells.
18325616 Our results suggest that HCV core protein may abrogate host cell RNA silencing defense by suppressing the ability of Dicer to process precursor dsRNAs into siRNAs.
18289125 the role of Dicer, one of the central proteins of the miRNA processing machinery during apoptosis, and show that down-regulation of Dicer results in accelerated apoptosis of HeLa cells, triggered by TNFalpha (tumour necrosis factor alpha).
18239938 Abnormal immunoexpression of Dicer in aggressive mucoepidermoid carcinoma suggests a role for microRNA and microRNA machinery in tumor progression.
18178619 Ago2, Dicer, and TRBP comprise the RISC-loading complex (RLC) and assembles spontaneously in vitro from purified components
18167183 DICER1 may play an important role in the development of cancer and the epigenetical regulation involved.
18023283 a role for the PAZ domain of Dicer in binding ssRNAs.
17663774 Results show that recombinant Dicer is capable of cleaving the TAR element in vitro and that TAR derived miRNA is present in HIV-1 infected cell lines and primary T-cell blasts.
17482383 a unique amino acid sequence in human DICER protein is essential for binding to Argonaute family proteins
17452327 Results indicate that human TRBP and PACT directly interact with each other and associate with Dicer to stimulate the cleavage of double-stranded or short hairpin RNA to siRNA.
17379831 Maintenance and regulation of endogenous microRNA levels via Dicer-mediated processing is critical for endothelial cell gene expression and functions in vitro.
17360756 These results suggest that, in the context of HIV replication, TRBP contributes mainly to the enhancement of virus production and that Dicer does not mediate HIV restriction by RNAi.
17332367 Overexpression of Dicer correlates with precancerous conditions for Lung adenocarcinoma.
17317629 Transcripts containing long hairpin structures composed of CNG repeats are another class of Dicer targets.
17303335 Up-regulation of TSSC3 occurred in Dicer knockdown cells.
17181864 Knockdown of Dicer by shRNA leads to inhibit enrichment of HIV-1 Gag in intracellular vacuoles, but enhance viral particle release in Gag expressing cells
17071602 Dicer up-regulation may explain an almost global increase of microRNA expression in prostate adenocarcinoma.
16582496 The C-terminal RNase III domain (RNase IIIb) of human Dicer was expressed, purified and crystallized by the sitting-drop vapour-diffusion method
16380083 RNA containing the AU-rich element of GM-CSF is destabilized by dicer and positive charge of proteins
15811921 various attributes of the 3' end structure, including overhang length and sequence composition, play a primary role in determining the position of Dicer cleavage in both dsRNA and unimolecular, short hairpin RNA
15247924 Dicer is essential for formation of the heterochromatin structure in vertebrate cells.
15242644 Dicer has a single RNA post-transcriptional processing center
14576312 fragile X syndrome CGG repeats readily form RNA hairpins and is digested by the human Dicer enzyme, a step central to the RNA interference effect on gene expression
12411505 purification and properties of a recombinant human Dicer
12411504 cloning and expression of the 218 kDa human Dicer, and characterization of its ribonuclease activity and dsRNA-binding properties

AA Sequence

MKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGK      1 - 70
TFIAVLLTKELSYQIRGDFSRNGKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSNLEVNASWTKERWNQ     71 - 140
EFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCENCPSCPRILGLTASIL    141 - 210
NGKCDPEELEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNF    211 - 280
INDCNISVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDT    281 - 350
FLRKIHALCEEHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDE    351 - 420
DEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPR    421 - 490
NKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPISNY    491 - 560
IMLADTDKIKSFEEDLKTYKAIEKILRNKCSKSVDTGETDIDPVMDDDDVFPPYVLRPDDGGPRVTINTA    561 - 630
IGHINRYCARLPSDPFTHLAPKCRTRELPDGTFYSTLYLPINSPLRASIVGPPMSCVRLAERVVALICCE    631 - 700
KLHKIGELDDHLMPVGKETVKYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRDSYPRPDQPCYL    701 - 770
YVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELKKSGFMLSL    771 - 840
QMLELITRLHQYIFSHILRLEKPALEFKPTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIP    841 - 910
STKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDL    911 - 980
TNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRK    981 - 1050
AVCLPSILYRLHCLLTAEELRAQTASDAGVGVRSLPADFRYPNLDFGWKKSIDSKSFISISNSSSAENDN   1051 - 1120
YCKHSTIVPENAAHQGANRTSSLENHDQMSVNCRTLLSESPGKLHVEVSADLTAINGLSYNQNLANGSYD   1121 - 1190
LANRDFCQGNQLNYYKQEIPVQPTTSYSIQNLYSYENQPQPSDECTLLSNKYLDGNANKSTSDGSPVMAV   1191 - 1260
MPGTTDTIQVLKGRMDSEQSPSIGYSSRTLGPNPGLILQALTLSNASDGFNLERLEMLGDSFLKHAITTY   1261 - 1330
LFCTYPDAHEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNWLPPGYVVNQDKSNTDKWEKD   1331 - 1400
EMTKDCMLANGKLDEDYEEEDEEEESLMWRAPKEEADYEDDFLEYDQEHIRFIDNMLMGSGAFVKKISLS   1401 - 1470
PFSTTDSAYEWKMPKKSSLGSMPFSSDFEDFDYSSWDAMCYLDPSKAVEEDDFVVGFWNPSEENCGVDTG   1471 - 1540
KQSISYDLHTEQCIADKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTDREKALCPTRENF   1541 - 1610
NSQQKNLSVSCAAASVASSRSSVLKDSEYGCLKIPPRCMFDHPDADKTLNHLISGFENFEKKINYRFKNK   1611 - 1680
AYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAV   1681 - 1750
KYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSELRRSEEDEEKEEDIEVPKAMGDIFESLAGAIY   1751 - 1820
MDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKF   1821 - 1890
KGVGRSYRIAKSAAARRALRSLKANQPQVPNS                                         1891 - 1922
//

Text Mined References (318)

PMID Year Title
27264823 2016 [Association of polymorphisms of miRNA biogenesis related genes DICER and DROSHA with azoospermia].
26976605 2016 Re-evaluation of the roles of DROSHA, Export in 5, and DICER in microRNA biogenesis.
26965998 2016 Jak-STAT3 pathway triggers DICER1 for proteasomal degradation by ubiquitin ligase complex of CUL4A(DCAF1) to promote colon cancer development.
26943961 2016 Dicer and microRNA expression in multiple sclerosis and response to interferon therapy.
26921501 2016 siRNA release from pri-miRNA scaffolds is controlled by the sequence and structure of RNA.
26858029 2016 The MYCN-HMGA2-CDKN2A pathway in non-small cell lung carcinoma--differences in histological subtypes.
26837267 2016 Endothelial Dicer promotes atherosclerosis and vascular inflammation by miRNA-103-mediated suppression of KLF4.
26772403 2016 Pediatric cystic nephromas: distinctive features and frequent DICER1 mutations.
26748703 2016 Essential Function of Dicer in Resolving DNA Damage in the Rapidly Dividing Cells of the Developing and Malignant Cerebellum.
26632874 2015 DICER1 and microRNA regulation in post-traumatic stress disorder with comorbid depression.
26621737 2015 Production of functional small interfering RNAs by an amino-terminal deletion mutant of human Dicer.
26577641 2016 DICER1 syndrome can mimic different genetic tumor predispositions.
26555935 2016 DICER1 Mutations and Differentiated Thyroid Carcinoma: Evidence of a Direct Association.
26513514 2016 DICER1 deletion and 14q32 microdeletion syndrome: an additional case and a review of the literature.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26428316 2015 A survey of DICER1 hotspot mutations in ovarian and testicular sex cord-stromal tumors.
26408257 2015 The oncogenic roles of DICER1 RNase IIIb domain mutations in ovarian Sertoli-Leydig cell tumors.
26289771 2016 Ovarian tumors related to intronic mutations in DICER1: a report from the international ovarian and testicular stromal tumor registry.
26227789 2015 Expression of the microRNA regulators Drosha, Dicer and Ago2 in non-small cell lung carcinomas.
26166215 2015 Dicer ablation promotes a mesenchymal and invasive phenotype in bladder cancer cells.
26156018 2015 High copy number variation of cancer-related microRNA genes and frequent amplification of DICER1 and DROSHA in lung cancer.
26147304 2015 3'-UTR Polymorphisms in the MiRNA Machinery Genes DROSHA, DICER1, RAN, and XPO5 Are Associated with Colorectal Cancer Risk in a Korean Population.
26087193 2015 Low DICER1 expression is associated with poor clinical outcome in adrenocortical carcinoma.
26076803 2015 Dysregulated expression of Dicer in invasive ductal breast carcinoma.
26033159 2015 Recurrent DICER1 hotspot mutations in endometrial tumours and their impact on microRNA biogenesis.
25990244 2015 Low DICER1 expression is associated with attenuated neutrophil differentiation and autophagy of NB4 APL cells.
25978641 2015 Fibroblast Growth Factor 9 Regulation by MicroRNAs Controls Lung Development and Links DICER1 Loss to the Pathogenesis of Pleuropulmonary Blastoma.
25977444 2015 The polymorphic terminal-loop of pre-miR-1307 binding with MBNL1 contributes to colorectal carcinogenesis via interference with Dicer1 recruitment.
25944670 2015 Dicer cleavage by calpain determines platelet microRNA levels and function in diabetes.
25911188 2015 Characterization of a naturally occurring truncated Dicer.
25896246 2015 Barrier Function of the Repaired Skin Is Disrupted Following Arrest of Dicer in Keratinocytes.
25883138 2015 The many faces of Dicer: the complexity of the mechanisms regulating Dicer gene expression and enzyme activities.
25867481 2015 Sequence features of Drosha and Dicer cleavage sites affect the complexity of isomiRs.
25752336 2015 Reduction of protein kinase C ? (PKC-?) promote apoptosis via down-regulation of Dicer in bladder cancer.
25702703 2015 DICER1 regulated let-7 expression levels in p53-induced cancer repression requires cyclin D1.
25656609 2015 EIF2C, Dicer, and Drosha are up-regulated along tumor progression and associated with poor prognosis in bladder carcinoma.
25640338 2015 Association between the DICER rs1057035 polymorphism and cancer risk: evidence from a meta-analysis of 1,2675 individuals.
25557550 2015 Dicer-TRBP complex formation ensures accurate mammalian microRNA biogenesis.
25549615 2015 Structure of precursor microRNA's terminal loop regulates human Dicer's dicing activity by switching DExH/D domain.
25526195 2014 Germline mutations of DICER1 in Chinese women with BRCA1/BRCA2-negative familial breast cancer.
25500911 2015 Cell- and developmental stage-specific Dicer1 ablation in the lung epithelium models cystic pleuropulmonary blastoma.
25480859 2015 Decreased Dicer expression is linked to increased expression of co-stimulatory molecule CD80 on B cells in multiple sclerosis.
25457613 2014 Rescuing dicer defects via inhibition of an anti-dicing nuclease.
25456905 2014 Dicer expression and microRNA dysregulation associate with aggressive features in thyroid cancer.
25446899 2014 Cancer exosomes perform cell-independent microRNA biogenesis and promote tumorigenesis.
25439752 2015 Overexpression of microRNA biogenesis machinery: Drosha, DGCR8 and Dicer in multiple sclerosis patients.
25428210 2015 Uncoupling of X-linked gene silencing from XIST binding by DICER1 and chromatin modulation on human inactive X chromosome.
25416952 2014 A variety of dicer substrates in human and C. elegans.
25361944 2015 Down-regulation of Dicer1 promotes cellular senescence and decreases the differentiation and stem cell-supporting capacities of mesenchymal stromal cells in patients with myelodysplastic syndrome.
25351418 2014 Hypoxia promotes stem cell phenotypes and poor prognosis through epigenetic regulation of DICER.
25349431 2014 DICER1/Alu RNA dysmetabolism induces Caspase-8-mediated cell death in age-related macular degeneration.
25295740 2015 Upregulation of microRNA processing enzymes Drosha and Dicer in gestational diabetes mellitus.
25195038 2014 Downregulated expression of Dicer1 predicts inferior survival in primary gastrointestinal diffuse large B-cell lymphoma treated with CHOP-like regimen and rituximab.
25190313 2014 Somatic mutations in DROSHA and DICER1 impair microRNA biogenesis through distinct mechanisms in Wilms tumours.
25176334 2014 DICER1: mutations, microRNAs and mechanisms.
25135428 2014 Down-regulation of Dicer and Ago2 is associated with cell proliferation and apoptosis in prostate cancer.
25123850 2014 Up-regulated expression of Dicer reveals poor prognosis in laryngeal squamous cell carcinoma.
25118636 2014 Nasal chondromesenchymal hamartomas arise secondary to germline and somatic mutations of DICER1 in the pleuropulmonary blastoma tumor predisposition disorder.
25115815 2014 Identification and characterization of Dicer1e, a Dicer1 protein variant, in oral cancer cells.
25061173 2014 Myeloma cell sensitivity to bortezomib is associated with Dicer1 expression.
25035295 2014 Probing the shRNA characteristics that hinder Dicer recognition and consequently allow Ago-mediated processing and AgoshRNA activity.
25031339 2014 Epstein-Barr virus EBNA1 protein regulates viral latency through effects on let-7 microRNA and dicer.
25022261 2014 Germ-line and somatic DICER1 mutations in pineoblastoma.
24987961 2014 Discovery of a dicer-independent, cell-type dependent alternate targeting sequence generator: implications in gene silencing & pooled RNAi screens.
24913918 2014 MicroRNA-581 promotes hepatitis B virus surface antigen expression by targeting Dicer and EDEM1.
24909177 2014 Exome sequencing of pleuropulmonary blastoma reveals frequent biallelic loss of TP53 and two hits in DICER1 resulting in retention of 5p-derived miRNA hairpin loop sequences.
24846461 2014 Silencing of Dicer1 temporally separates pro- and anti-apoptotic signaling and confers susceptibility to chemotherapy in p53 mutated cells.
24839956 2014 Pituitary blastoma: a pathognomonic feature of germ-line DICER1 mutations.
24821309 2014 Judicious DICER1 testing and surveillance imaging facilitates early diagnosis and cure of pleuropulmonary blastoma.
24817967 2014 Dysregulation of microRNA biosynthesis enzyme Dicer plays an important role in gastric cancer progression.
24814348 2014 Human nuclear Dicer restricts the deleterious accumulation of endogenous double-stranded RNA.
24787017 2014 Prognostic significance of low DICER expression regulated by miR-130a in cervical cancer.
24769857 2014 Genetic variants in microRNA machinery genes are associated [corrected] with idiopathic recurrent pregnancy loss risk.
24725360 2014 The expression of Dicer and Drosha in matched normal tissues, tumours and lymph node metastases in triple negative breast cancer.
24676997 2014 Down-regulation of Dicer expression in cervical cancer tissues.
24676357 2014 Expanding the phenotype of mutations in DICER1: mosaic missense mutations in the RNase IIIb domain of DICER1 cause GLOW syndrome.
24675358 2014 Biallelic DICER1 mutations in sporadic pleuropulmonary blastoma.
24668803 2014 A microRNA processing defect in smokers' macrophages is linked to SUMOylation of the endonuclease DICER.
24617712 2014 Exploring the association Between DICER1 mutations and differentiated thyroid carcinoma.
24574065 2014 Complexity in regulation of microRNA machinery components in invasive breast carcinoma.
24486018 2014 A phosphate-binding pocket within the platform-PAZ-connector helix cassette of human Dicer.
24481001 2014 DICER1 mutations in childhood cystic nephroma and its relationship to DICER1-renal sarcoma.
24462910 2014 Molecular characterization, tissue distribution, and expression of two ovarian Dicer isoforms during follicle development in goose (Anser cygnoides).
24386264 2013 Prognostic significance of deregulated dicer expression in breast cancer.
24337369 2014 Suppression of collagen synthesis by Dicer gene silencing in hepatic stellate cells.
24324261 2014 The Hippo pathway effectors TAZ/YAP regulate dicer expression and microRNA biogenesis through Let-7.
24317682 2014 Silencing Dicer expression enhances cellular proliferative and invasive capacities in human tongue squamous cell carcinoma.
24287487 2013 Cyclin D1 induction of Dicer governs microRNA processing and expression in breast cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24244599 2013 Dicer expression exhibits a tissue-specific diurnal pattern that is lost during aging and in diabetes.
24223844 2013 MiR-192 directly binds and regulates Dicer1 expression in neuroblastoma.
24220032 2014 Mutant p53 regulates Dicer through p63-dependent and -independent mechanisms to promote an invasive phenotype.
24204924 2013 A new short oligonucleotide-based strategy for the precursor-specific regulation of microRNA processing by dicer.
24163352 2013 MicroRNA-directed program of cytotoxic CD8+ T-cell differentiation.
24136150 2013 DICER1 hotspot mutations in non-epithelial gonadal tumours.
24096488 2014 Impaired DICER1 function promotes stemness and metastasis in colon cancer.
24094887 2014 Dicer is down-regulated in clear cell renal cell carcinoma and in vitro Dicer knockdown enhances malignant phenotype transformation.
24065110 2014 Germ-line deletion in DICER1 revealed by a novel MLPA assay using synthetic oligonucleotides.
24025624 2013 Arginine rich short linear motif of HIV-1 regulatory proteins inhibits dicer dependent RNA interference.
23882114 2013 The double-stranded RNA binding domain of human Dicer functions as a nuclear localization signal.
23868705 2013 Potentially functional genetic variants in microRNA processing genes and risk of HBV-related hepatocellular carcinoma.
23868280 2013 Germ-line and somatic DICER1 mutations in a pleuropulmonary blastoma.
23851498 2014 A dosage-dependent pleiotropic role of Dicer in prostate cancer growth and metastasis.
23849790 2013 The HIV-1 protein Vpr targets the endoribonuclease Dicer for proteasomal degradation to boost macrophage infection.
23763383 2013 DICER1 exons 25 and 26 mutations are rare in common human tumours besides Sertoli-Leydig cell tumour.
23741051 2013 Hsp90 cochaperones p23 and FKBP4 physically interact with hAgo2 and activate RNA interference-mediated silencing in mammalian cells.
23728841 2013 Novel DICER1 mutation as cause of multinodular goiter in children.
23663110 2013 Expression of genes for microRNA-processing enzymes is altered in advanced non-alcoholic fatty liver disease.
23661684 2013 Differential roles of human Dicer-binding proteins TRBP and PACT in small RNA processing.
23625684 2013 DICER1 syndrome: a new cancer syndrome.
23624860 2013 Substrate-specific structural rearrangements of human Dicer.
23622242 2013 ADAR1 forms a complex with Dicer to promote microRNA processing and RNA-induced gene silencing.
23620094 2013 Biallelic DICER1 mutations occur in Wilms tumours.
23550157 2013 RNA-induced silencing complex (RISC) Proteins PACT, TRBP, and Dicer are SRA binding nuclear receptor coregulators.
23547758 2013 Germ-line DICER1 mutations do not make a major contribution to the etiology of familial testicular germ cell tumours.
23519840 2013 The regulatory mechanism of CCR7 gene expression and its involvement in the metastasis and progression of gastric cancer.
23472152 2013 Concordant and discordant regulation of target genes by miR-31 and its isoforms.
23468895 2013 Decreased dicer expression enhances SRP-mediated protein targeting.
23441612 2013 Identification of microRNAs regulated by isothiocyanates and association of polymorphisms inside their target sites with risk of sporadic colorectal cancer.
23426981 2013 Overexpression of DICER1 induced by the upregulation of GATA1 contributes to the proliferation and apoptosis of leukemia cells.
23418872 2013 Mutation analysis of DICER1 gene in hematologic tumors.
23392577 2013 miR-130b is an EMT-related microRNA that targets DICER1 for aggression in endometrial cancer.
23349018 2013 DICER1, DROSHA and miRNAs in patients with non-small cell lung cancer: implications for outcomes and histologic classification.
23311378 2013 Mild hyperthermia enhances the expression and induces oscillations in the Dicer protein.
23307239 2013 Reduced expression of Dicer11 is associated with poor prognosis in patients with nasopharyngeal carcinoma.
23266047 2013 Dicer and Drosha expression and response to Bevacizumab-based therapy in advanced colorectal cancer patients.
23251602 2012 Variation in dicer gene is associated with increased survival in T-cell lymphoma.
23222681 2012 The role of dicer in DNA damage repair.
23192594 2013 Gene-environment interactions and obesity traits among postmenopausal African-American and Hispanic women in the Women's Health Initiative SHARe Study.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23143396 2012 Selective autophagy degrades DICER and AGO2 and regulates miRNA activity.
23141545 2012 The loop position of shRNAs and pre-miRNAs is critical for the accuracy of dicer processing in vivo.
23071822 2012 Genetic variations in key microRNA processing genes and risk of head and neck cancer: a case-control study in Chinese population.
23068969 2012 DICER1 RNase IIIb domain mutations are infrequent in testicular germ cell tumours.
23064648 2012 DICER- and AGO3-dependent generation of retinoic acid-induced DR2 Alu RNAs regulates human stem cell proliferation.
23063121 2012 Human RNA methyltransferase BCDIN3D regulates microRNA processing.
23047949 2012 Regulation of human Dicer by the resident ER membrane protein CLIMP-63.
22999255 2012 Requirements for human Dicer and TRBP in microRNA-122 regulation of HCV translation and RNA abundance.
22984192 2012 A comprehensive analysis of precursor microRNA cleavage by human Dicer.
22972926 2012 MicroRNAs control the maintenance of thymic epithelia and their competence for T lineage commitment and thymocyte selection.
22922797 2012 miR-3928 activates ATR pathway by targeting Dicer.
22867905 2012 Exploring the endocrine manifestations of DICER1 mutations.
22821364 2012 Loss of Dicer expression is associated with breast cancer progression and recurrence.
22808238 2012 Dicer-dependent biogenesis of small RNAs derived from 7SL RNA.
22766726 2013 Inducing cell proliferation inhibition and apoptosis via silencing Dicer, Drosha, and Exportin 5 in urothelial carcinoma of the bladder.
22745131 2012 Functional importance of Dicer protein in the adaptive cellular response to hypoxia.
22737231 2012 MicroRNAs are indispensable for reprogramming mouse embryonic fibroblasts into induced stem cell-like cells.
22727743 2012 Coordinated activities of human dicer domains in regulatory RNA processing.
22718634 2012 A fluorescence correlation spectroscopy-based enzyme assay for human Dicer.
22716222 2012 Down-regulation of the microRNA processing enzyme Dicer is a prognostic factor in human colorectal cancer.
22689055 2013 Sox4-mediated Dicer expression is critical for suppression of melanoma cell invasion.
22647351 2012 Argonaute, Dicer, and Drosha are up-regulated along tumor progression in serous ovarian carcinoma.
22615744 2012 Reduced mature microRNA levels in association with dicer loss in human temporal lobe epilepsy with hippocampal sclerosis.
22546613 2012 In vivo structure-function analysis of human Dicer reveals directional processing of precursor miRNAs.
22541070 2012 DICER1 loss and Alu RNA induce age-related macular degeneration via the NLRP3 inflammasome and MyD88.
22479364 2012 Knock-down of core proteins regulating microRNA biogenesis has no effect on sensitivity of lung cancer cells to ionizing radiation.
22446887 2012 Dicer 1, ribonuclease type III modulates a reprogramming effect in colorectal cancer cells.
22426548 2012 The molecular architecture of human Dicer.
22407237 2012 Clinicopathological and prognostic significance of microRNA-107 and its relationship to DICER1 mRNA expression in gastric cancer.
22394132 2012 Immunohistochemical analysis of the endoribonucleases Drosha, Dicer and Ago2 in smooth muscle tumours of soft tissues.
22381205 2012 Genetic variants in microRNA biogenesis pathway genes are associated with semen quality in a Han-Chinese population.
22371183 2012 Impaired expression of DICER, DROSHA, SBDS and some microRNAs in mesenchymal stromal cells from myelodysplastic syndrome patients.
22350415 2012 miRNA-130a targets ATG2B and DICER1 to inhibit autophagy and trigger killing of chronic lymphocytic leukemia cells.
22320315 2012 Downregulated Dicer expression predicts poor prognosis in chronic lymphocytic leukemia.
22310293 2012 Inhibition of miR-9 de-represses HuR and DICER1 and impairs Hodgkin lymphoma tumour outgrowth in vivo.
22252463 2012 Reduced DICER1 elicits an interferon response in endometrial cancer cells.
22187960 2012 Recurrent somatic DICER1 mutations in nonepithelial ovarian cancers.
22180160 2012 DICER1 mutations in embryonal rhabdomyosarcomas from children with and without familial PPB-tumor predisposition syndrome.
22179432 2012 Downregulation of Dicer, a component of the microRNA machinery, in bladder cancer.
22163034 2011 The role of Dicer protein partners in the processing of microRNA precursors.
22133720 2011 miRNA processing and human cancer: DICER1 cuts the mustard.
22055188 2011 MCPIP1 ribonuclease antagonizes dicer and terminates microRNA biogenesis through precursor microRNA degradation.
21953080 2012 The microRNA-processing enzymes: Drosha and Dicer can predict prognosis of nasopharyngeal carcinoma.
21937200 2011 High expression of Dicer reveals a negative prognostic influence in certain subtypes of primary cutaneous T cell lymphomas.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21898071 2012 Dysregulated expression of dicer and drosha in breast cancer.
21889945 2011 Mutagens interfere with microRNA maturation by inhibiting DICER. An in silico biology analysis.
21882293 2011 Extending the phenotypes associated with DICER1 mutations.
21878538 2011 Dicer-mediated upregulation of BCRP confers tamoxifen resistance in human breast cancer cells.
21858095 2011 Nuclear pore complex protein mediated nuclear localization of dicer protein in human cells.
21827717 2011 Dicer and miRNA in relation to clinicopathological variables in colorectal cancer patients.
21769619 2011 Expression of the ribonucleases Drosha, Dicer, and Ago2 in colorectal carcinomas.
21761362 2010 MicroRNAs link estrogen receptor alpha status and Dicer levels in breast cancer.
21753850 2011 Dicer recognizes the 5' end of RNA for efficient and accurate processing.
21698147 2011 Up-regulated Dicer expression in patients with cutaneous melanoma.
21559780 2011 Major regulators of microRNAs biogenesis Dicer and Drosha are down-regulated in endometrial cancer.
21501861 2011 Ovarian sex cord-stromal tumors, pleuropulmonary blastoma and DICER1 mutations: a report from the International Pleuropulmonary Blastoma Registry.
21425145 2011 DICER1 expression and outcomes in endometrioid endometrial adenocarcinoma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21346072 2011 Distinct expression pattern of Dicer1 correlates with ovarian-derived steroid hormone receptor expression in human Fallopian tubes during ovulation and the midsecretory phase.
21345667 2011 Overexpression of Dicer predicts poor survival in colorectal cancer.
21306637 2011 Two-step cleavage of hairpin RNA with 5' overhangs by human DICER.
21297638 2011 Competition for XPO5 binding between Dicer mRNA, pre-miRNA and viral RNA regulates human Dicer levels.
21297615 2011 DICER1 deficit induces Alu RNA toxicity in age-related macular degeneration.
21269460 2011 Initial characterization of the human central proteome.
21266384 2011 DICER1 syndrome: clarifying the diagnosis, clinical features and management implications of a pleiotropic tumour predisposition syndrome.
21205968 2011 DICER1 mutations in familial multinodular goiter with and without ovarian Sertoli-Leydig cell tumors.
21160068 2011 Upregulation of Dicer is more frequent in monoclonal gammopathies of undetermined significance than in multiple myeloma patients and is associated with longer survival in symptomatic myeloma patients.
21048142 2010 MicroRNA loss enhances learning and memory in mice.
21044367 2010 An integrative method for scoring candidate genes from association studies: application to warfarin dosing.
21036787 2010 Germline DICER1 mutations and familial cystic nephroma.
21029372 2011 MicroRNA-107, an oncogene microRNA that regulates tumour invasion and metastasis by targeting DICER1 in gastric cancer.
20974746 2010 Short RNA duplexes guide sequence-dependent cleavage by human Dicer.
20962848 2010 TAp63 suppresses metastasis through coordinate regulation of Dicer and miRNAs.
20932845 2010 Substrate-specific kinetics of Dicer-catalyzed RNA processing.
20869963 2010 Interaction of human T-cell lymphotropic virus type I Rex protein with Dicer suppresses RNAi silencing.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20805302 2010 microRNA signature and expression of Dicer and Drosha can predict prognosis and delineate risk groups in neuroblastoma.
20732906 2010 Genetic variations in microRNA-related genes are associated with survival and recurrence in patients with renal cell carcinoma.
20730047 2010 Dicer is associated with ribosomal DNA chromatin in mammalian cells.
20721975 2010 Association of a common AGO1 variant with lung cancer risk: a two-stage case-control study.
20615407 2010 A novel splice variant of the human dicer gene is expressed in neuroblastoma cells.
20584909 2010 Absence of DICER in monocytes and its regulation by HIV-1.
20550935 2010 Lineage-specific transcriptional regulation of DICER by MITF in melanocytes.
20530258 2010 Dicer-dependent microRNAs control maturation, function, and maintenance of Langerhans cells in vivo.
20463238 2010 Dicer in Schwann cells is required for myelination and axonal integrity.
20405249 2011 Down-regulation of Dicer in hepatocellular carcinoma.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
20237275 2010 Dicer is required for the transition from early to late progenitor state in the developing mouse retina.
20232482 2010 Overexpression of dicer as a result of reduced let-7 MicroRNA levels contributes to increased cell proliferation of oral cancer cells.
20211803 2010 Black carbon exposures, blood pressure, and interactions with single nucleotide polymorphisms in MicroRNA processing genes.
20210522 2010 Expression levels of the microRNA processing enzymes Drosha and dicer in epithelial skin cancer.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
19914350 2010 Dicer knockdown induces fibronectin-1 expression in HEK293T cells via induction of Egr1.
19851984 2010 Genetic variation in MicroRNA genes and risk of oral premalignant lesions.
19836333 2009 Structure of the human Dicer-TRBP complex by electron microscopy.
19820710 2009 Structural insights into RNA processing by the human RISC-loading complex.
19806572 2009 [The effect of silencing Dicer by small interference RNA on the biological characteristics of human glioma cells].
19804757 2009 Phosphorylation of the human microRNA-generating complex mediates MAPK/Erk signaling.
19782670 2010 Down-regulation of dicer expression in ovarian cancer tissues.
19716330 2009 Mammalian miRNA RISC recruits CAF1 and PABP to affect PABP-dependent deadenylation.
19701182 2009 An RNA-dependent RNA polymerase formed by TERT and the RMRP RNA.
19678941 2009 Refractoriness of hepatitis C virus internal ribosome entry site to processing by Dicer in vivo.
19672267 2009 Prognostic value of Dicer expression in human breast cancers and association with the mesenchymal phenotype.
19646895 2009 Role of Dicer in female fertility.
19556464 2009 DICER1 mutations in familial pleuropulmonary blastoma.
19520829 2009 Dicer-regulated microRNAs 222 and 339 promote resistance of cancer cells to cytotoxic T-lymphocytes by down-regulation of ICAM-1.
19422693 2009 Characterization of the TRBP domain required for dicer interaction and function in RNA interference.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19393748 2009 Differential expression of Dicer and Argonaute genes during the differentiation of human neuroblastoma cells.
19219043 2009 A TARBP2 mutation in human cancer impairs microRNA processing and DICER1 function.
19155329 2009 Phosphorylation of FMRP inhibits association with Dicer.
19138993 2008 Genetic variations in microRNA-related genes are novel susceptibility loci for esophageal cancer risk.
19127773 2008 [Dicer interacts with Wig-1 protein].
19118902 2009 Dicer is regulated by cellular stresses and interferons.
19092150 2008 Dicer, Drosha, and outcomes in patients with ovarian cancer.
19082437 2009 Knockdown of Dicer in MCF-7 human breast carcinoma cells results in G1 arrest and increased sensitivity to cisplatin.
19047128 2008 Single nucleotide polymorphisms of microRNA machinery genes modify the risk of renal cell carcinoma.
19022417 2009 Human Dicer C-terminus functions as a 5-lipoxygenase binding domain.
19017633 2009 Human Dicer binds short single-strand and double-strand RNA with high affinity and interacts with different regions of the nucleic acids.
18978195 2008 Downregulation of Dicer expression by serum withdrawal sensitizes human endothelial cells to apoptosis.
18927112 2008 A role for the Dicer helicase domain in the processing of thermodynamically unstable hairpin RNAs.
18700235 2008 let-7 regulates Dicer expression and constitutes a negative feedback loop.
18690212 2008 Prolyl 4-hydroxylation regulates Argonaute 2 stability.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18644891 2008 Decreased Dicer expression elicits DNA damage and up-regulation of MICA and MICB.
18637735 2008 Chemical modification patterns compatible with high potency dicer-substrate small interfering RNAs.
18508075 2008 Autoinhibition of human dicer by its internal helicase domain.
18413723 2008 A requirement for DICER to maintain full promoter CpG island hypermethylation in human cancer cells.
18325616 2008 HCV core protein interacts with Dicer to antagonize RNA silencing.
18289125 2008 Stimuli-dependent cleavage of Dicer during apoptosis.
18239938 2008 Mucoepidermoid carcinoma of upper aerodigestive tract: clinicopathologic study of 78 cases with immunohistochemical analysis of Dicer expression.
18178619 2008 In vitro reconstitution of the human RISC-loading complex.
18167183 2007 Decreased expression of DICER1 in gastric cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18023283 2007 In vitro binding of single-stranded RNA by human Dicer.
17932509 2007 Proteomic and functional analysis of Argonaute-containing mRNA-protein complexes in human cells.
17920623 2007 Homodimeric structure and double-stranded RNA cleavage activity of the C-terminal RNase III domain of human dicer.
17663774 2007 HIV-1 TAR element is processed by Dicer to yield a viral micro-RNA involved in chromatin remodeling of the viral LTR.
17531811 2007 RNA helicase A interacts with RISC in human cells and functions in RISC loading.
17507929 2007 MicroRNA silencing through RISC recruitment of eIF6.
17482383 2007 Evolutionary conservation of a unique amino acid sequence in human DICER protein essential for binding to Argonaute family proteins.
17452327 2007 Human TRBP and PACT directly interact with each other and associate with dicer to facilitate the production of small interfering RNA.
17379831 2007 Dicer dependent microRNAs regulate gene expression and functions in human endothelial cells.
17360756 2007 Small interfering RNAs against the TAR RNA binding protein, TRBP, a Dicer cofactor, inhibit human immunodeficiency virus type 1 long terminal repeat expression and viral production.
17332367 2007 Overexpression of Dicer in precursor lesions of lung adenocarcinoma.
17317629 2007 Ribonuclease dicer cleaves triplet repeat hairpins into shorter repeats that silence specific targets.
17303335 2007 Upregulation of PHLDA2 in Dicer knockdown HEK293 cells.
17071602 2006 Up-regulation of dicer, a component of the MicroRNA machinery, in prostate adenocarcinoma.
16582496 2006 Crystallization and preliminary X-ray analysis of the C-terminal RNase III domain of human Dicer.
16424907 2006 The role of PACT in the RNA silencing pathway.
16380083 2006 Dicer and positive charge of proteins decrease the stability of RNA containing the AU-rich element of GM-CSF.
16357216 2005 A human, ATP-independent, RISC assembly machine fueled by pre-miRNA.
16289642 2005 Identification of novel argonaute-associated proteins.
16271387 2005 Human RISC couples microRNA biogenesis and posttranscriptional gene silencing.
16142218 2005 TRBP, a regulator of cellular PKR and HIV-1 virus expression, interacts with Dicer and functions in RNA silencing.
16095561 2005 Extensive variation in the 5'-UTR of Dicer mRNAs influences translational efficiency.
15987463 2005 Alternative initiation and splicing in dicer gene expression in human breast cells.
15973356 2005 TRBP recruits the Dicer complex to Ago2 for microRNA processing and gene silencing.
15811921 2005 The contributions of dsRNA structure to Dicer specificity and efficiency.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15247924 2004 Dicer is essential for formation of the heterochromatin structure in vertebrate cells.
15242644 2004 Single processing center models for human Dicer and bacterial RNase III.
14749716 2004 Characterization of the interactions between mammalian PAZ PIWI domain proteins and Dicer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14576312 2003 The fragile X syndrome repeats form RNA hairpins that do not activate the interferon-inducible protein kinase, PKR, but are cut by Dicer.
12906857 2003 Identification of eight members of the Argonaute family in the human genome.
12527779 2003 Short hairpin type of dsRNAs that are controlled by tRNA(Val) promoter significantly induce RNAi-mediated gene silencing in the cytoplasm of human cells.
12526743 2003 Short-interfering-RNA-mediated gene silencing in mammalian cells requires Dicer and eIF2C translation initiation factors.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12411505 2002 Human Dicer preferentially cleaves dsRNAs at their termini without a requirement for ATP.
12411504 2002 Ribonuclease activity and RNA binding of recombinant human Dicer.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
12110183 2002 The dsRNA binding protein RDE-4 interacts with RDE-1, DCR-1, and a DExH-box helicase to direct RNAi in C. elegans.
11452083 2001 A cellular function for the RNA-interference enzyme Dicer in the maturation of the let-7 small temporal RNA.
11201747 2001 Role for a bidentate ribonuclease in the initiation step of RNA interference.
10786632 2000 Molecular cloning and characterization of a novel human gene (HERNA) which encodes a putative RNA-helicase.
10727850 2000 Identification of a novel human member of the DEAD box protein family.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10051563 1999 Interaction of 5-lipoxygenase with cellular proteins.
9345104 1997 Familial nontoxic multinodular thyroid goiter locus maps to chromosome 14q but does not account for familial nonmedullary thyroid cancer.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
4162574 1966 Unusual familial goiter associated with intrathyroidal calcification.
3799599 1986 An autosomal dominant form of adolescent multinodular goiter.