Property Summary

NCBI Gene PubMed Count 27
PubMed Score 56.59
PubTator Score 24.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma 1.200 1.5e-03
osteosarcoma -1.475 7.1e-03
posterior fossa group B ependymoma 2.200 2.7e-12
atypical teratoid / rhabdoid tumor 1.200 3.6e-06
group 3 medulloblastoma 1.200 5.3e-03
medulloblastoma, large-cell 1.700 1.4e-06
adrenocortical carcinoma 1.739 2.6e-04
intraductal papillary-mucinous carcinoma... 1.400 6.8e-03
intraductal papillary-mucinous neoplasm ... 2.000 1.1e-03
lung cancer 1.600 3.0e-03
nasopharyngeal carcinoma 1.100 2.3e-03
Endometriosis 1.266 1.2e-02
Breast cancer 2.000 2.0e-05
psoriasis 1.600 5.3e-92

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (15)

PMID Text
26446836 we use a simple cellular system to examine fundamental features of formin-mediated filopodial assembly, using constitutively active constructs of the formins mDia2 and FMNL3
26179371 results suggest that inhibition of MT stability arising from DIAPH3 downregulation enhances susceptibility to MT poisons, and that the DIAPH3 network potentially reports taxane sensitivity in human tumors
24587343 An mDia2/ROCK signaling axis regulates invasive egress from epithelial ovarian cancer spheroids.
24403606 Dia1, Dia2, and Dia3 are involved in ErbB2-dependent capture of microtubules at the cell leading edge and ErbB2-driven guided migration.
23580645 TGF-beta promotes association of mDia2 with actin stress fibers, which further drives stress fiber formation and myofibroblast differentiation
22593025 In human tumours, DIAPH3 down-regulation was associated with aggressive or metastatic disease.
22184005 isoform-selective actin assembly by DIAPH3 exerts specific and differentially regulated functions during cell adhesion and motility.
21397845 These findings reveal a key role for mDia3 and its regulation by Aurora B phosphorylation in achieving proper stable kinetochore microtubule attachment.
21119010 the amino terminus of mDia2 serves as a coincidence detection module, directing mDia2 to the plasma membrane through interactions with phospholipids and activated Rif
19457867 mDia2 is degraded at the end of mitosis; mDia2 is targeted for disposal by post-translational ubiquitin modification; forced expression of activated mDia2 yields binucleate cells due to failed cytokinesis
18755006 active Drf3 lacking the C-terminal regulatory region (Drf3DeltaDAD) induced the formation of filopodia and accumulated at their tips.
18516090 Results suggest that WAVE and the Arp2/3 complex jointly orchestrate different types of actin-based plasma membrane protrusions by promoting ruffling and inhibiting mDia2-induced filopodia.
17855386 Data show that Dia2 localizes in the lamella of migrating epithelial cells, where it is involved in the formation of a stable pool of cortical actin and in maintenance of polymerization-competent free filament barbed ends at focal adhesions.
17398099 DIP-induced membrane blebbing was dependent on Diaphanous 2 but did not require the activities of either Diaphanous 1 or Actin-Related Protein 2-3 Complex.
17198702 These studies further suggest that Rho GTPases significantly influence the activity of mDia family formins in driving cellular membrane remodeling through the regulation of actin dynamics.

AA Sequence

MERHQPRLHHPAQGSAAGTPYPSSASLRGCRESKMPRRKGPQHPPPPSGPEEPGEKRPKFHLNIRTLTDD      1 - 70
MLDKFASIRIPGSKKERPPLPNLKTAFASSDCSAAPLEMMENFPKPLSENELLELFEKMMEDMNLNEDKK     71 - 140
APLREKDFSIKKEMVMQYINTASKTGSLKRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPVSW    141 - 210
VESFGHEGLGLLLDILEKLISGKIQEKVVKKNQHKVIQCLKALMNTQYGLERIMSEERSLSLLAKAVDPR    211 - 280
HPNMMTDVVKLLSAVCIVGEESILEEVLEALTSAGEEKKIDRFFCIVEGLRHNSVQLQVACMQLINALVT    281 - 350
SPDDLDFRLHIRNEFMRCGLKEILPNLKCIKNDGLDIQLKVFDEHKEEDLFELSHRLEDIRAELDEAYDV    351 - 420
YNMVWSTVKETRAEGYFISILQHLLLIRNDYFIRQQYFKLIDECVSQIVLHRDGMDPDFTYRKRLDLDLT    421 - 490
QFVDICIDQAKLEEFEEKASELYKKFEKEFTDHQETQAELQKKEAKINELQAELQAFKSQFGALPADCNI    491 - 560
PLPPSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLPGMRMPFSGPVPPPPPLGFLGGQNSPPLPIL    561 - 630
PFGLKPKKEFKPEISMRRLNWLKIRPHEMTENCFWIKVNENKYENVDLLCKLENTFCCQQKERREEEDIE    631 - 700
EKKSIKKKIKELKFLDSKIAQNLSIFLSSFRVPYEEIRMMILEVDETRLAESMIQNLIKHLPDQEQLNSL    701 - 770
SQFKSEYSNLCEPEQFVVVMSNVKRLRPRLSAILFKLQFEEQVNNIKPDIMAVSTACEEIKKSKSFSKLL    771 - 840
ELVLLMGNYMNAGSRNAQTFGFNLSSLCKLKDTKSADQKTTLLHFLVEICEEKYPDILNFVDDLEPLDKA    841 - 910
SKVSVETLEKNLRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSRFVISAKEQYETLSKLHENMEKLYQS    911 - 980
IIGYYAIDVKKVSVEDFLTDLNNFRTTFMQAIKENIKKREAEEKEKRVRIAKELAERERLERQQKKKRLL    981 - 1050
EMKTEGDETGVMDNLLEALQSGAAFRDRRKRTPMPKDVRQSLSPMSQRPVLKVCNHENQKVQLTEGSRSH   1051 - 1120
YNINCNSTRTPVAKELNYNLDTHTSTGRIKAAEKKEACNVESNRKKETELLGSFSKNESVPEVEALLARL   1121 - 1190
RAL                                                                      1191 - 1193
//

Text Mined References (31)

PMID Year Title
26446836 2015 Cell type-dependent mechanisms for formin-mediated assembly of filopodia.
26179371 2015 Regulation of microtubule dynamics by DIAPH3 influences amoeboid tumor cell mechanics and sensitivity to taxanes.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24587343 2014 An mDia2/ROCK signaling axis regulates invasive egress from epithelial ovarian cancer spheroids.
24403606 2014 Essential and nonredundant roles for Diaphanous formins in cortical microtubule capture and directed cell migration.
23580645 2013 Control of myofibroblast differentiation by microtubule dynamics through a regulated localization of mDia2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22593025 2012 DIAPH3 governs the cellular transition to the amoeboid tumour phenotype.
22184005 2012 Differing and isoform-specific roles for the formin DIAPH3 in plasma membrane blebbing and filopodia formation.
21397845 2011 Aurora B regulates formin mDia3 in achieving metaphase chromosome alignment.
21269460 2011 Initial characterization of the human central proteome.
21119010 2011 Mechanisms of plasma membrane targeting of formin mDia2 through its amino terminal domains.
20624953 2010 Increased activity of Diaphanous homolog 3 (DIAPH3)/diaphanous causes hearing defects in humans with auditory neuropathy and in Drosophila.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19457867 2009 Ubiquitin-mediated degradation of the formin mDia2 upon completion of cell division.
18755006 2008 Filopodia formation induced by active mDia2/Drf3.
18516090 2008 WAVE and Arp2/3 jointly inhibit filopodium formation by entering into a complex with mDia2.
18044991 2007 Novel roles of formin mDia2 in lamellipodia and filopodia formation in motile cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17855386 2007 mDia2 regulates actin and focal adhesion dynamics and organization in the lamella for efficient epithelial cell migration.
17398099 2007 Dia-interacting protein modulates formin-mediated actin assembly at the cell cortex.
17198702 2007 RhoB and the mammalian Diaphanous-related formin mDia2 in endosome trafficking.
15520414 2004 A gene responsible for autosomal dominant auditory neuropathy (AUNA1) maps to 13q14-21.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14767582 2004 Identification and characterization of human DIAPH3 gene in silico.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
563699 1977 An interpretation of human diaphorase isozymes in terms of three gene loci DIA1, DIA2 and DIA3.