Property Summary

NCBI Gene PubMed Count 170
PubMed Score 955.23
PubTator Score 519.52

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (8)

PDB (11)

Gene RIF (128)

AA Sequence

MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSS      1 - 70
EALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGAR     71 - 140
AEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAE    141 - 210
AQIEELRQKTQEEGEERAESEQEAYLRED                                             211 - 239
//

Text Mined References (174)

PMID Year Title