Property Summary

NCBI Gene PubMed Count 163
PubMed Score 912.88
PubTator Score 519.52

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Protein-protein Interaction (12)

Gene RIF (121)

PMID Text
26575016 Report role of RIP1 in Smac mimetic mediated chemosensitization of neuroblastoma cells.
26567362 This review discusses the promise as well as some challenges at the translational interface of exploiting Smac mimetics as cancer therapeutics.
26134559 Data show that mitochondrial X-linked inhibitor of apoptosis protein (XIAP) entry requires apoptosis regulatory proteins Bax or Bak through mitochondrial permeabilization and Smac/DIABLO protein degradation.
25889084 SapC-DOPS acts through a mitochondria-mediated pathway accompanied by an early release of Smac and Bax.
25650938 Smac-DIABLO adopts a tetrameric assembly in solution.
25586349 this is the first demonstration that a dual approach using simultaneous overexpression of a cell penetrable form of Smac and TRAIL sensitize and promote apoptotic process even in resistant breast cancer cells.
25577253 Preoperative measurement of serum VEGF, survivin, and Smac/DIABLO may be of help in early detection of serous ovarian cancer and may provide important information about the patient's outcome and prognosis.
25549803 Data indicate that Smac/DIABLO showed an inverse correlation with inhibitor of apoptosis proteins XIAP, cIAP-1 and cIAP-2.
25501823 IRF1 is a dual regulator of BV6-induced apoptosis and inflammatory cytokine secretion.
25337193 Describe a new alternatively spliced isoform of Smac which promotes thr formation of mammospheres.
25310587 The phosphorylation of Smac at the Nterminal serine 6 residue is functionally linked to Smac release during TNFalphainduced apoptosis.
25080938 Within mitochondria, XIAP selectively signals lysosome- and proteasome-associated degradation of its inhibitor Smac.
24916695 CLIC4, ERp29, and Smac/DIABLO integrated into a novel panel based on cancer stem-like cells in association with metastasis stratify the prognostic risks of colorectal cancer.
24841289 XIAP, cIAP1, and cIAP2, members of inhibitor of apoptosis (IAP) proteins, are critical regulators of cell death and survival; the SMAC/DIABLO protein is an endogenous antagonist of XIAP, cIAP1, and cIAP2
24771354 It represents a powerful way to enhance the destruction of cancer cells and increase the efficiency and duration of gene expression required for apoptosis.
24317109 The present study indicated the significance of Smac and survivin in determining the breast cancer response to anthracyclinebased chemotherapy, and may permit further stratifying of prechemotherapy patients to undertake more tailored treatments.
23990677 We report that an Smac-mimetic selectively induces TNF-alpha-dependent cystic renal epithelial cell death, leading to the removal of cystic epithelial cells from renal tissues and delaying cyst formation.
23857156 Smac/DIABLO decreases the proliferation and increases the apoptosis of hypertrophic scar fibroblasts.
23699656 Results show that Smac mimetics exerts an antitumor effect on nasopharyngeal carcinoma cancer stem cells.
23479728 Identification of a novel anti-apoptotic E3 ubiquitin ligase that ubiquitinates antagonists of inhibitor of apoptosis proteins SMAC, HtrA2, and ARTS.
23252748 Overexpression of Smac promotes Cisplatin-induced apoptosis by activating caspase-3 and caspase-9 in lung cancer.
23207240 Data indicate that the formation of cytochrome c-Apaf-1 apoptosome and the presence of Smac are absolutely required for PSAP-induced apoptosis.
23156805 Smac, XIAP, caspase 3 might be associated with the growth and carcinogenesis of nonnasal inverted papilloma.
22848756 differential redistribution of cyt c and Smac occurs under various conditions
22751125 Results demonstrate an essential and apoptosis-independent function of SMAC in tumor suppression and provide new insights into the biology and targeting of colon cancer.
22590594 these data suggest a new mechanism by which NOXA chemosensitized ovarian cancer cells to cisplatin by inducing alterations in the Bax/Smac axis.
22549017 The activin A signals via SMAD proteins, but not TAK1 or p38, to regulate murine and ovine Fshb transcription in gonadotrope-like cells.
22534537 Higher expression of Smac and Ki-67 appear to play a role in the pathogenesis of pancreatic cancer. Combined detection of these proteins may improve the prognostic evaluation of this disease.
22528226 Over-expression of cellular Smac can inhibit inhibitor of apoptosis proteins (IAPs), enhance caspases activity and the apoptosis rate of PC-3 cells induced by TRAIL, which may provide a useful experimental basis for prostate cancer therapy.
22482401 Data show that the apoptosis rate of Eca109/Smac was significantly increased with the concentration of cispaltin increased.
22333553 The over-expression of PTEN gene may inhibit the proliferation of K562 cells and promote cell apoptosis via the regulation of Survivin, Xiap and Smac genes.
22320973 The levels of cellular apoptosis-associated proteins such as Smac/DIABLO, Cyto C, and the activated fragment of caspase-3 increased in pancreatic cancer cells, but the expression of XIAP was significantly decreased after 24 h treatment with the combination of TRAIL and gemcitabine.
22218530 Overall, the findings suggest that measuring the levels of Smac/DIABLO in the serum may be considered a prognostic parameter in patients with bladder cancer.
22161156 Expressions of SMAC/DIABLO and survivin were significantly reciprocal in breast cancer and benign tumor tissues.
22028622 Data show that Smac mimetic- and TNFalpha-mediated cell death occurs without characteristic features of apoptosis (i.e., caspase activation, DNA fragmentation) in FADD-deficient cells.
21869827 Translocation of ARTS initiates a first wave of caspase activation leading to the subsequent release of additional mitochondrial factors, including cytochrome C and SMAC/Diablo.
21744997 Low Smac expression is associated with breast cancer.
21722859 DFNA64 genotype is the human genetic disorder associated with DIABLO malfunction and suggests that mutant DIABLO(S71L) might cause mitochondrial dysfunction.
21676925 Data suggest that downregulation of Smac may be a chemoresistance mechanism in ESCC.
21478115 Patients with positive smac/DIABLO tumors had a longer disease-specific survival when compared with those with negative tumors in the 10-year follow-up.
21354220 The dimerization of Smac is critical for the XIAP-mediated retention of Smac at or inside the mitochondria.
21242120 Results establish a critical role of Smac in mediating therapeutic responses of HNSCC cells and provide a strong rationale for combining Smac mimetics with other anticancer agents to treat HNSCC.
21204765 Results indicate important roles of Smac in suppressing lung cancer cell growth and sensitivity to chemotherapeutic drugs.
21055155 With the malignant development of ovarian mucinous tumors, the expressions of Survivin are up-regulated, and the expressions of Smac are down-regulated.
20980180 Results describe molecular docking and dynamics simulations of the binding of XIAP-BIR3 with three groups of Smac mimetics.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20596678 Smac/DIABLO expression in bladder cancer may be used as a prognostic parameter, and low Smac/DIABLO expression in bladder cancer may be associated with resistance to chemotherapy.
20572591 Smac/DIABLO plays a pivotal role in attaining a synergistic effect in Hep-2 cells in response to this combined strategy.
20537984 Smac/DIABLO, a proapoptotic molecule, was identified as a protein that interacts with Hip2.
20395960 The release of Smac/DIABLO proved to be crucial for full effector caspase activity and clonogenic execution.
20063052 Adenosine downregulated the expression of mRNAs and proteins for Bcl-X(L) and inhibitor of apoptosis protein 2 (IAP2) to directly inhibit caspase-3, -7, and -9, but upregulated the expression of mRNA and protein for DIABLO, an inhibitor of IAPs.
20061022 Smac/DIABLO protein expression is associated with higher sensitivity to standard chemotherapy and a longer overall survival in AML patients.
20056675 Our data suggest that assessment of survivin and second mitochondria-derived activator of caspase mRNA expression may be useful for predicting survival in non-small cell lung cancer patients receiving platinum-based chemotherapy after surgical resection
19913121 Observational study of gene-disease association. (HuGE Navigator)
19875445 Membrane-associated XIAP induces mitochondrial outer membrane permeabilization leading to cytochrome c and Smac release, which is dependent on Bax and Bak.
19635196 The expression and correlation of Livin and Smac/DIABLO vary in different stages and pathological types of gastric carcinoma.
19500507 Data show that antagonism with Smac could downregulate the protein expression of survivin and sensitize the response of pancreatic cancer to chemotherapeutic agents, which emerged as a potential and effective therapeutic strategy for pancreatic cancer.
19148507 decrease of Smac/DIABLO expression is an independent factor determining the poorer prognosis of patients with colorectal cancer.
18979398 These data suggest that a down-regulation of Smac/DIABLO and HtrA2 is implicated in the development and progression of TGCT, whereas overexpression of XAF1 in TGCT might contribute to their extraordinary sensitivity to chemotherapy.
18856066 the increase of level of survivin in tumor tissues is not the result of decrease in content of its inhibitors SMAC and PML, as their content in tumor and normal cells is the same.
18822208 The pro-apoptotic Smac gene could be over-expressed in hepatocarcinoma SMMC-7721 cells and inhibit cell growth, induce apoptosis and enhance the chemotherapeutic sensitivity to cisplatin.
18663754 deletion of genes SMAC in early-stage mycosis fungoides
18660514 Expression of full-length Par-4 in human-bone mesenchymal cells resulted in increased activity of the Smac promoter.
18401527 Thus, survivin, Smac, and PKC alpha might play important roles in the inhibition of apoptosis by FGF-2 in human small cell lung cancer cells.
18307314 extremely high stability of the dimeric form of Smac/DIABLO also implies that once expressed in the cell the protein has a low probability of dissociation and, consequently, loss of function.
18091317 up-regulated expression of SMAC can antagonize the antiapoptotic potential of inhibitor of apoptosis proteins and promote apoptotic muscle fiber disassembly and loss
18060880 These data indicate that S100A8/A9-induced cell death involves Bak, selective release of Smac/DIABLO and Omi/HtrA2 from mitochondria, and modulation of the balance between pro- and anti-apoptotic proteins.
18029193 Decreased expression of Smac protein may play a role in ovarian carcinogenesis and chemotherapeutic resistance.
17997990 Translocation of Bax was essential for TIP30-induced apoptosis, whereas overexpression of the anti-apoptotic protein Bcl-xL delayed both second mitochondria-derived activator of caspases (Smac/DIABLO) release and onset of apoptosis.
17996648 In response to autocrine TNFalpha signaling, the Smac mimetic promotes formation of a RIPK1-dependent caspase-8-activating complex, leading to apoptosis
17967504 Radiation-induced apoptosis of tumor cells is increased by inhibition of the interaction between Survivin and Smac/DIABLO.
17959540 Expression of survivin and Smac regulated cell cycle and apoptosis in ovarian cancer cells.
17922292 expression of Smac/DIABLO, but not Omi/HtrA2, is inversely associated with outcome of renal cell carcinoma patients.
17724022 XIAP homotrimerizes via its C-terminal Ring domain, making its inhibitory activity toward caspase-3 more susceptible to Smac.
17666167 Impaired kinetics of Bax-GFP and Smac/DIABLO-GFP in caspase 8 and bid-silenced and Bcl-2-overexpressed breast cancer cells exposed to camptothecin.
17653087 MnSOD-overexpressing cells showed reduced cytochrome c and no Smac/DIABLO release into the cytosol.
17630921 decreased levels of Smac/DIABLO may be important in chemoradiation-resistance to apoptosis in advanced colon cancer [review]
17603079 Inhibitor of apoptosis proteins, nuclear factor-kappa, Smac/DIABLO and apoptosis inducing factor were increased in colon cancer cells.
17546047 Mitochondrial survivin associates with Smac/DIABLO, delaying its release.
17521628 Results indicate that the suppression of IAPs expression by Smac/DIABLO shortly after proapoptotic stimulation might play a role in the mechanisms of apoptotic induction.
17440818 An obligatory role for Smac/DIABLO in these tumor cells during several pathways of apoptosis induction.
17320350 These results show that cyclic AMP is an important modulator of the apoptotic threshold in cancer cell by means of regulating Smac/DIABLO expression.
17291493 Our findings indicate that the use of small molecule Smac mimic, when combined with an apoptotic trigger, may have therapeutic potential for the treatment of NSCLC.
17277885 TRAF3 interacts with Smac/DIABLO via TRAF domain, leading to an increased proapoptotic effect of Smac/DIABLO in cytoplasm.
17237824 Second mitochondria-derived activator of caspase (SMAC)/Diablo participates in a feedback amplification loop to promote cytochrome c release and other mitochondrial events in apoptosis.
17223373 These data suggest that Rv1818c-induced apoptotic signaling is likely regulated in part by the Smac-dependent activation of caspases in T cells.
17140287 HIV-1 Vpr-induced apoptosis through caspase activation and Smac release from mitochondria is dependent on G2 cell cycle arrest , but is lost in cells synchronized in G1/S
17045968 This suggests that the balance between cellular Smac/DIABLO and Survivin levels could be critical for cellular destiny in taxane-treated cancer cells.
16949641 Smac/DIABLO is differentially expressed in various types of B-cell non-Hodgkin lymphomas and Hodgkin lymphomas, suggesting that apoptotic mechanisms are differentially involved in the pathogenesis of these diseases
16868249 In HL cells, grzB-induced mitochondrial release of proapoptotic Smac is blocked, which results in complete abrogation of cytotoxicity mediated by CTLs.
16732934 Apoptosis induced by bufalin is related to mitochondrial release of Smac/DIABLO.
16484020 SMAC/DIABLO mutations in gastric and colorectal carcinomas suggest their role in the development of these tumors.
16282325 a single cIAP can direct its E3 ligase activity toward different substrates and can alter the cellular functions of different protein targets, including TRAF2 and SMAC, in accordance with differences in the specificity of individual BIR domains
16091752 A novel function of SMAC, inhibition of clonogenic tumor growth, contributes to its antitumor activity.
16083549 Data show that Transfection and expression of human Smac gene could significantly induce apoptosis of human Burkitt's lymphoma Raji cells.
15843890 in HeLa cells, both Smac and Cyt-c are released from mitochondria during UV-induced apoptosis through the same permeability transition mechanism triggered by aggregation of Bax
15541727 Expression of Smac/DIABLO can stimulate the intrinsic pathway of apoptosis in ovarian carcinoma without damaging normal ovarian tissue and therefore has therapeutic potential.
15537572 electrostatic interations do not hold Smac/DIABLO to mitochondrial membranes
15300255 Apollon binds to, ubiquitinates and facilitates proteasomal degradation of SMAC and caspase-9, results suggesting that Apollon has an essential function in preventing SMAC-induced apoptosis
15242764 Smac deficiency may be compensated for by action of redundant determinants to kill cancer cells. Thus, translocation of endogenous Smac into cytosol does not play a critical role in cell death of human lung carcinoma after etoposide treatment.
14960576 Smac may serve as a key molecule in vivo to selectively reduce the protein level of c-IAPs through the ubiquitin/proteasome pathway
14570909 compared Grim and Diablo. Although they have the same IAP binding specificity, only Grim promoted XIAP ubiquitination and degradation.
14560006 Data show that the mechanism by which fibroblast growth factor 2 protects small cell lung cancer cells from etoposide-induced cell death involves inhibition of Smac release but not of cytochrome c release.
14523016 Smac3 is a novel Smac/DIABLO splicing variant and attenuates the stability and apoptosis-inhibiting activity of XIAP
14512414 role in relieving XIAP-mediated caspase inhibition
12975347 The duration of Smac release was greater than that of cytochrome c. However, there was no difference in the time to the onset of release, and both cytochrome c and Smac release coincided with mitochondrial membrane potential depolarization.
12855565 Blocking Hsp27 by an antisense strategy restores the apoptotic response to Dex in Dex-resistant MM cells by triggering the release of mitochondrial protein Smac
12766489 The sustained release of Smac/DIABLO from mitochondria is an important event for the onset of apoptosis in keratinocytes exposed to UVB irradiation. In human keratinocytes UVB irradiation at 500 J/m(2), but not at 150 J/m(2), induces apoptosis.
12749848 Transfection of ovarian carcinoma cells with Smac causes apoptosis. Smac-induced apoptosis proceeds via a pathway mediated by caspase-9 and is inhibited by XIAP protein.
12665525 Smac is released during stress-induced apoptosis in multiple myeloma cells
12642862 role in leukemic cell apoptosis
12571250 TRAF2, TRAF3, cIAP1, Smac, and lymphotoxin beta receptor associate and are involved in apoptosis
12525502 Cellular inhibitors of apoptosis 1 and 2 are ubiquitin ligases for the apoptosis inducer Smac/DIABLO.
12388702 Reovirus-induced apoptosis requires mitochondrial release of Smac/DIABLO
12364342 translocation of Smac along with cytochrome c and other mitochondrial pro-apoptotic proteins represent important regulatory checkpoints for mitochondria-mediated apoptosis
12218061 Smac-penetratin fusion peptide crossed the cellular membrane, bound XIAP and cIAP1, displaced caspase-3 from cytoplasmic aggregates, and enhanced drug-induced caspase action in situ
12121969 SMAC protein is regulated by XIAP and degraded by proteasome
12118245 Data show that transfer of the gene encoding Smac sensitized tumor and malignant glioma cells for apoptosis, and that Smac peptides enhanced the antitumor activity of Apo-2L/tumor necrosis factor-related apoptosis-inducing ligand (TRAIL).
11964312 potentiates epothilone B derivative-(BMS 247550) and Apo-2L/TRAIL-induced apoptosis
11801595 prevention of mitochondrial release by bcl-2 and bcl-xL inhibition of CD95-mediated apoptosis

AA Sequence

MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSS      1 - 70
EALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGAR     71 - 140
AEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAE    141 - 210
AQIEELRQKTQEEGEERAESEQEAYLRED                                             211 - 239
//

Text Mined References (167)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26575016 2015 Differential role of RIP1 in Smac mimetic-mediated chemosensitization of neuroblastoma cells.
26567362 2015 Promises and Challenges of Smac Mimetics as Cancer Therapeutics.
26134559 2015 Bax/Bak-dependent, Drp1-independent Targeting of X-linked Inhibitor of Apoptosis Protein (XIAP) into Inner Mitochondrial Compartments Counteracts Smac/DIABLO-dependent Effector Caspase Activation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25889084 2015 SapC-DOPS nanovesicles induce Smac- and Bax-dependent apoptosis through mitochondrial activation in neuroblastomas.
25650938 2015 The activator of apoptosis Smac-DIABLO acts as a tetramer in solution.
25586349 2015 Bypassing the need for pre-sensitization of cancer cells for anticancer TRAIL therapy with secretion of novel cell penetrable form of Smac from hA-MSCs as cellular delivery vehicle.
25577253 2015 Prognostic significance of pretreatment VEGF, survivin, and Smac/DIABLO serum levels in patients with serous ovarian carcinoma.
25549803 2015 Prognostic value of inhibitor of apoptosis protein family expression in patients with acute myeloid leukemia.
25501823 2014 Identification of IRF1 as critical dual regulator of Smac mimetic-induced apoptosis and inflammatory cytokine response.
25416956 2014 A proteome-scale map of the human interactome network.
25337193 2014 Ectopic expression of new alternative splice variant of Smac/DIABLO increases mammospheres formation.
25310587 2014 JNK1?mediated phosphorylation of Smac/DIABLO at the serine 6 residue is functionally linked to its mitochondrial release during TNF??-?induced apoptosis of HeLa cells.
25080938 2014 Intramitochondrial recruitment of endolysosomes mediates Smac degradation and constitutes a novel intrinsic apoptosis antagonizing function of XIAP E3 ligase.
24916695 2014 CLIC4, ERp29, and Smac/DIABLO derived from metastatic cancer stem-like cells stratify prognostic risks of colorectal cancer.
24841289 2014 Small-molecule SMAC mimetics as new cancer therapeutics.
24771354 2014 SMAC-armed vaccinia virus induces both apoptosis and necroptosis and synergizes the efficiency of vinblastine in HCC.
24317109 2014 Clinical significance of Smac and survivin expression in breast cancer patients treated with anthracycline?based neoadjuvant chemotherapy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23990677 2013 Smac-mimetic-induced epithelial cell death reduces the growth of renal cysts.
23857156 2013 Smac/DIABLO regulates the apoptosis of hypertrophic scar fibroblasts.
23699656 2013 Smac mimetics in combination with TRAIL selectively target cancer stem cells in nasopharyngeal carcinoma.
23618690 2013 Single-agent Smac-mimetic compounds induce apoptosis in B chronic lymphocytic leukaemia (B-CLL).
23539542 2012 Promotion of Caspase Activation by Caspase-9-mediated Feedback Amplification of Mitochondrial Damage.
23538445 2013 Identification of non-canonical NF-?B signaling as a critical mediator of Smac mimetic-stimulated migration and invasion of glioblastoma cells.
23479728 2013 Identification of a novel anti-apoptotic E3 ubiquitin ligase that ubiquitinates antagonists of inhibitor of apoptosis proteins SMAC, HtrA2, and ARTS.
23403634 2013 The novel SMAC mimetic birinapant exhibits potent activity against human melanoma cells.
23393362 2013 Immunoexpression of DIABLO, AIF and cytochrome C in gastric adenocarcinoma assessed by tissue Microarray.
23252748 2013 Overexpression of Smac promotes Cisplatin-induced apoptosis by activating caspase-3 and caspase-9 in lung cancer A549 cells.
23251006 2013 Impairment of glioma stem cell survival and growth by a novel inhibitor for Survivin-Ran protein complex.
23240027 2012 Smac mimetic SM-164 potentiates APO2L/TRAIL- and doxorubicin-mediated anticancer activity in human hepatocellular carcinoma cells.
23225169 2013 Smac mimetic Birinapant induces apoptosis and enhances TRAIL potency in inflammatory breast cancer cells in an IAP-dependent and TNF-?-independent mechanism.
23207240 2013 PSAP induces a unique Apaf-1 and Smac-dependent mitochondrial apoptotic pathway independent of Bcl-2 family proteins.
23156805 2012 [The expression and significance of smac, XIAP, caspase-3 in nonnasal inverted papilloma].
22848756 2012 Application of flow cytometry to determine differential redistribution of cytochrome c and Smac/DIABLO from mitochondria during cell death signaling.
22751125 2013 An apoptosis-independent role of SMAC in tumor suppression.
22590594 2012 NOXA-induced alterations in the Bax/Smac axis enhance sensitivity of ovarian cancer cells to cisplatin.
22549017 2012 Activin A induction of murine and ovine follicle-stimulating hormone ? transcription is SMAD-dependent and TAK1 (MAP3K7)/p38 MAPK-independent in gonadotrope-like cells.
22534537 Clinical significance of Smac and Ki-67 expression in pancreatic cancer.
22528226 2012 Effect of Smac on TRAIL-induced apoptosis of prostate cancer cell line PC-3 and the molecular mechanism.
22482401 2012 [Overexpression of Smac gene enhanced chemotherapeutic sensitivity of esophageal cancer cell line Eca109 to cisplatin].
22465666 2012 Identification of a novel protein kinase C?-Smac complex that dissociates during paclitaxel-induced cell death.
22333553 2011 [Regulation of wild type PTEN gene on Survivin, Xiap and Smac in chronic leukemia cells].
22320973 2011 Mechanisms of TRAIL and gemcitabine induction of pancreatic cancer cell apoptosis.
22218530 2012 Low circulating serum levels of second mitochondria-derived activator of caspase (Smac/DIABLO) in patients with bladder cancer.
22161156 2012 Reciprocal expression of survivin and SMAC/DIABLO in primary breast cancer.
22028622 2011 Smac mimetic bypasses apoptosis resistance in FADD- or caspase-8-deficient cells by priming for tumor necrosis factor ?-induced necroptosis.
21869827 2012 The IAP-antagonist ARTS initiates caspase activation upstream of cytochrome C and SMAC/Diablo.
21744997 2011 Correlation of Smac/DIABLO protein expression with the clinico-pathological features of breast cancer patients.
21722859 2011 Functional mutation of SMAC/DIABLO, encoding a mitochondrial proapoptotic protein, causes human progressive hearing loss DFNA64.
21676925 2011 Role of Smac in determining the chemotherapeutic response of esophageal squamous cell carcinoma.
21536684 2011 Survivin monomer plays an essential role in apoptosis regulation.
21478115 2010 Prognostic significance of smac/DIABLO in endometrioid endometrial cancer.
21354220 2011 Dimerization of Smac is crucial for its mitochondrial retention by XIAP subsequent to mitochondrial outer membrane permeabilization.
21269460 2011 Initial characterization of the human central proteome.
21242120 2011 Smac modulates chemosensitivity in head and neck cancer cells through the mitochondrial apoptotic pathway.
21204765 2010 Knockdown of second mitochondria-derived activator of caspase expression by RNAi enhances growth and cisplatin resistance of human lung cancer cells.
21185211 2011 ARTS and Siah collaborate in a pathway for XIAP degradation.
21055155 2010 [Expression and significance of Survivin and Smac in ovarian mucinous tumors].
20980180 2010 Theoretical studies on the interactions of XIAP-BIR3 domain with bicyclic and tricyclic core monovalent Smac mimetics.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20596678 2010 Prognostic significance of second mitochondria-derived activator of caspase (Smac/DIABLO) expression in bladder cancer and target for therapy.
20572591 Overexpression of Smac/DIABLO in Hep-2 cell line: possible role in potentiating the sensitivity of chemotherapeutic drugs.
20537984 2010 Hip2 interacts with and destabilizes Smac/DIABLO.
20395960 2010 Smac/DIABLO release from mitochondria and XIAP inhibition are essential to limit clonogenicity of Type I tumor cells after TRAIL receptor stimulation.
20063052 2010 Adenosine-induced caspase-3 activation by tuning Bcl-XL/DIABLO/IAP expression in HuH-7 human hepatoma cells.
20061022 2010 Influence of high expression of Smac/DIABLO protein on the clinical outcome in acute myeloid leukemia patients.
20056675 2010 Survivin and Smac gene expressions but not livin are predictors of prognosis in non-small cell lung cancer patients treated with adjuvant chemotherapy following surgery.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19875445 2010 Role for X-linked Inhibitor of apoptosis protein upstream of mitochondrial permeabilization.
19635196 2009 [Expression and clinical significance of apoptosis associated genes Livin and Smac/DIABLO in human gastric carcinomas].
19500507 2009 [Interference of survivin in pancreatic cancer Bx-PC3 cell line with Smac sensitizing its response to cisplatin].
19153467 2009 The structure of the BIR3 domain of cIAP1 in complex with the N-terminal peptides of SMAC and caspase-9.
19148507 2009 Clinical significance of Smac/DIABLO expression in colorectal cancer.
18979398 2008 [Expression levels of the IAP antagonists XAF1, Smac/DIABLO and HtrA2 in testicular germ cell tumours].
18856066 [Increase of BIRC5 gene expression in non-small cell lung cancer and esophageal squamous cell carcinoma does not correlate with expression of genes SMAC/DIABLO and PML encoding its inhibitors].
18822208 2008 [Effects of over-expressed Smac gene coupling with cisplatin on proliferation and apoptosis of hepatocarcinoma cells].
18663754 2008 Array-based comparative genomic hybridization in early-stage mycosis fungoides: recurrent deletion of tumor suppressor genes BCL7A, SMAC/DIABLO, and RHOF.
18660514 2008 Multimolecular complex of Par-4 and E2F1 binding to Smac promoter contributes to glutamate-induced apoptosis in human- bone mesenchymal stem cells.
18401527 2008 Inhibition of fibroblast growth factor 2-induced apoptosis involves survivin expression, protein kinase C alpha activation and subcellular translocation of Smac in human small cell lung cancer cells.
18309324 2008 No death without life: vital functions of apoptotic effectors.
18307314 2008 The proapoptotic protein Smac/DIABLO dimer has the highest stability as measured by pressure and urea denaturation.
18091317 2008 SMAC-expression in denervated human skeletal muscle as a potential inhibitor of coexpressed inhibitor-of-apoptosis proteins.
18060880 2008 S100A8/9 induces cell death via a novel, RAGE-independent pathway that involves selective release of Smac/DIABLO and Omi/HtrA2.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18029193 2007 Transfection of Smac/DIABLO sensitizes drug-resistant tumor cells to TRAIL or paclitaxel-induced apoptosis in vitro.
17997990 2008 Tip30-induced apoptosis requires translocation of Bax and involves mitochondrial release of cytochrome c and Smac/DIABLO in hepatocellular carcinoma cells.
17996648 2007 Autocrine TNFalpha signaling renders human cancer cells susceptible to Smac-mimetic-induced apoptosis.
17967504 2008 Radiation-induced apoptosis of tumor cells is facilitated by inhibition of the interaction between Survivin and Smac/DIABLO.
17959540 2007 [Effects of survivin antisense oligonucleotides on survivin and Smac gene expression in ovarian cancer cells].
17922292 2008 Expression levels of the mitochondrial IAP antagonists Smac/DIABLO and Omi/HtrA2 in clear-cell renal cell carcinomas and their prognostic value.
17724022 2007 A dimeric Smac/diablo peptide directly relieves caspase-3 inhibition by XIAP. Dynamic and cooperative regulation of XIAP by Smac/Diablo.
17666167 2007 Impaired kinetics of Bax-GFP and Smac/DIABLO-GFP in caspase-8- and bid-silenced and Bcl-2 overexpressed breast cancer MCF-7 cells exposed to camptothecin.
17653087 2008 MnSOD protects colorectal cancer cells from TRAIL-induced apoptosis by inhibition of Smac/DIABLO release.
17630921 2007 Smac/DIABLO and colon cancer.
17603079 2007 Modification of gene products involved in resistance to apoptosis in metastatic colon cancer cells: roles of Fas, Apaf-1, NFkappaB, IAPs, Smac/DIABLO, and AIF.
17546047 2007 Regulation of mitochondrial Smac/DIABLO-selective release by survivin.
17521628 2007 Rapid induction of IAP family proteins and Smac/DIABLO expression after proapoptotic stimulation with doxorubicin in RPMI 8226 multiple myeloma cells.
17440818 2007 Smac/DIABLO is required for effector caspase activation during apoptosis in human cells.
17320350 2007 Apoptosis induced by cAMP requires Smac/DIABLO transcriptional upregulation.
17291493 2007 Role of XIAP in inhibiting cisplatin-induced caspase activation in non-small cell lung cancer cells: a small molecule Smac mimic sensitizes for chemotherapy-induced apoptosis by enhancing caspase-3 activation.
17277885 2007 TRAF3 interacts with Smac/DIABLO and enhances the proapoptotic effect of Smac/DIABLO in cytoplasm.
17237824 2007 SMAC/Diablo mediates the proapoptotic function of PUMA by regulating PUMA-induced mitochondrial events.
17223373 2007 Apoptosis triggered by Rv1818c, a PE family gene from Mycobacterium tuberculosis is regulated by mitochondrial intermediates in T cells.
17045968 2006 Nuclear interaction of Smac/DIABLO with Survivin at G2/M arrest prompts docetaxel-induced apoptosis in DU145 prostate cancer cells.
16949641 2006 Expression of Smac/DIABLO in B-cell non-Hodgkin and Hodgkin lymphomas.
16868249 2006 XIAP targeting sensitizes Hodgkin lymphoma cells for cytolytic T-cell attack.
16732934 2006 [Downregulation of Bcl-2 and survivin expression and release of Smac/DIABLO involved in bufalin-induced HL-60 cell apoptosis].
16729033 2006 Livin promotes Smac/DIABLO degradation by ubiquitin-proteasome pathway.
16541075 2006 The finished DNA sequence of human chromosome 12.
16484020 2006 SMAC/DIABLO mutation is uncommon in gastric and colorectal carcinomas.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16282325 2006 Distinct BIR domains of cIAP1 mediate binding to and ubiquitination of tumor necrosis factor receptor-associated factor 2 and second mitochondrial activator of caspases.
16091752 2005 Inhibition of clonogenic tumor growth: a novel function of Smac contributing to its antitumor activity.
16083549 2005 [The cloning of human Smac gene and its pro-apoptotic effect on Burkitt's lymphoma cells].
15843890 2005 Smac/DIABLO and cytochrome c are released from mitochondria through a similar mechanism during UV-induced apoptosis.
15628841 2005 Solution structure of human survivin and its binding interface with Smac/Diablo.
15541727 2005 Survivin interacts with Smac/DIABLO in ovarian carcinoma cells but is redundant in Smac-mediated apoptosis.
15537572 2005 Mitochondrial release of pro-apoptotic proteins: electrostatic interactions can hold cytochrome c but not Smac/DIABLO to mitochondrial membranes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15300255 2004 Apollon ubiquitinates SMAC and caspase-9, and has an essential cytoprotection function.
15242764 2004 Endogenously released Smac is insufficient to mediate cell death of human lung carcinoma in response to etoposide.
15200957 2004 Dual role of BRUCE as an antiapoptotic IAP and a chimeric E2/E3 ubiquitin ligase.
15178455 2004 Direct interaction of Smac with NADE promotes TRAIL-induced apoptosis.
14960576 2004 Smac/DIABLO selectively reduces the levels of c-IAP1 and c-IAP2 but not that of XIAP and livin in HeLa cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14570909 2004 Unlike Diablo/smac, Grim promotes global ubiquitination and specific degradation of X chromosome-linked inhibitor of apoptosis (XIAP) and neither cause apoptosis.
14560006 2003 Fibroblast growth factor 2-mediated translational control of IAPs blocks mitochondrial release of Smac/DIABLO and apoptosis in small cell lung cancer cells.
14523016 2003 Smac3, a novel Smac/DIABLO splicing variant, attenuates the stability and apoptosis-inhibiting activity of X-linked inhibitor of apoptosis protein.
14512414 2003 Requirement of both the second and third BIR domains for the relief of X-linked inhibitor of apoptosis protein (XIAP)-mediated caspase inhibition by Smac.
12975347 2003 Real-time single cell analysis of Smac/DIABLO release during apoptosis.
12855565 2003 Hsp27 inhibits release of mitochondrial protein Smac in multiple myeloma cells and confers dexamethasone resistance.
12766489 2003 Sustained release of Smac/DIABLO from mitochondria commits to undergo UVB-induced apoptosis.
12749848 2003 Expression of Smac/DIABLO in ovarian carcinoma cells induces apoptosis via a caspase-9-mediated pathway.
12665525 2003 JNK-dependent release of mitochondrial protein, Smac, during apoptosis in multiple myeloma (MM) cells.
12660240 2003 Direct interaction between survivin and Smac/DIABLO is essential for the anti-apoptotic activity of survivin during taxol-induced apoptosis.
12642862 2003 Role of Smac in human leukaemic cell apoptosis and proliferation.
12571250 2003 Endogenous association of TRAF2, TRAF3, cIAP1, and Smac with lymphotoxin beta receptor reveals a novel mechanism of apoptosis.
12559088 2003 Comparative gene identification-94--a pivotal regulator of apoptosis.
12525502 2003 Cellular inhibitor of apoptosis 1 and 2 are ubiquitin ligases for the apoptosis inducer Smac/DIABLO.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388702 2002 Reovirus-induced apoptosis requires mitochondrial release of Smac/DIABLO and involves reduction of cellular inhibitor of apoptosis protein levels.
12364342 2002 The kinetics of translocation of Smac/DIABLO from the mitochondria to the cytosol in HeLa cells.
12218061 2002 Synthetic Smac/DIABLO peptides enhance the effects of chemotherapeutic agents by binding XIAP and cIAP1 in situ.
12121969 2002 Proteasome-mediated degradation of Smac during apoptosis: XIAP promotes Smac ubiquitination in vitro.
12118245 2002 Smac agonists sensitize for Apo2L/TRAIL- or anticancer drug-induced apoptosis and induce regression of malignant glioma in vivo.
11964312 2002 Ectopic overexpression of second mitochondria-derived activator of caspases (Smac/DIABLO) or cotreatment with N-terminus of Smac/DIABLO peptide potentiates epothilone B derivative-(BMS 247550) and Apo-2L/TRAIL-induced apoptosis.
11801603 2002 SMAC negatively regulates the anti-apoptotic activity of melanoma inhibitor of apoptosis (ML-IAP).
11726499 2001 Apoptosis-associated release of Smac/DIABLO from mitochondria requires active caspases and is blocked by Bcl-2.
11604410 2002 HtrA2 promotes cell death through its serine protease activity and its ability to antagonize inhibitor of apoptosis proteins.
11323712 2001 A structural view of mitochondria-mediated apoptosis.
11285287 2001 The inhibitor of apoptosis protein-binding domain of Smac is not essential for its proapoptotic activity.
11257231 2001 Structural basis of caspase inhibition by XIAP: differential roles of the linker versus the BIR domain.
11242052 2001 A conserved XIAP-interaction motif in caspase-9 and Smac/DIABLO regulates caspase activity and apoptosis.
11181995 2001 The sequence of the human genome.
11140638 2000 Structural basis of IAP recognition by Smac/DIABLO.
11140637 2000 Structural basis for binding of Smac/DIABLO to the XIAP BIR3 domain.
10972280 2000 Structural and biochemical basis of apoptotic activation by Smac/DIABLO.
10950947 2000 Molecular determinants of the caspase-promoting activity of Smac/DIABLO and its role in the death receptor pathway.
10929712 2000 Identification of DIABLO, a mammalian protein that promotes apoptosis by binding to and antagonizing IAP proteins.
10929711 2000 Smac, a mitochondrial protein that promotes cytochrome c-dependent caspase activation by eliminating IAP inhibition.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.