Property Summary

NCBI Gene PubMed Count 108
PubMed Score 734.25
PubTator Score 137.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma 1.900 2.3e-03
atypical teratoid / rhabdoid tumor 1.300 5.4e-03
ependymoma 2.400 6.5e-04
Gaucher disease type 1 -2.600 3.3e-03
glioblastoma 1.600 5.1e-03
group 3 medulloblastoma 1.300 5.7e-04
lung cancer 1.400 3.1e-02
medulloblastoma, large-cell 2.700 6.5e-04
Multiple myeloma 1.380 8.7e-04
oligodendroglioma 2.600 1.0e-03
osteosarcoma 1.374 3.6e-03
pediatric high grade glioma 1.400 2.4e-03
primitive neuroectodermal tumor 1.200 5.1e-03
psoriasis 1.300 1.2e-04

Gene RIF (57)

AA Sequence

MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLV      1 - 70
RINEIKSEEVPAFGVASPPPLTDTPDTTANAEGDLPTTMGGPLPPHLALKAENNSEVGASGYGVPGPTWD     71 - 140
RGANLKDYYSRKEEQEVQATLESEEVDLNAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRS    141 - 210
FIAEMTIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVVEAYSGLTKKKEGETVEPYKVNLSQ    211 - 280
DLEHQLQNIIQELNLEILPPPEDPSVPVALNIGKLAQFEPSQRQNQVGVVPWSPPQSNWNPWTSSNIDEG    281 - 350
PLAFATPEQISMDLKNELMYQLEQDHDLQAILQERELLPVKKFESEILEAISQNSVVIIRGATGCGKTTQ    351 - 420
VPQFILDDFIQNDRAAECNIVVTQPRRISAVSVAERVAFERGEEPGKSCGYSVRFESILPRPHASIMFCT    421 - 490
VGVLLRKLEAGIRGISHVIVDEIHERDINTDFLLVVLRDVVQAYPEVRIVLMSATIDTSMFCEYFFNCPI    491 - 560
IEVYGRTYPVQEYFLEDCIQMTHFVPPPKDKKKKDKDDDGGEDDDANCNLICGDEYGPETRLSMSQLNEK    561 - 630
ETPFELIEALLKYIETLNVPGAVLVFLPGWNLIYTMQKHLEMNPHFGSHRYQILPLHSQIPREEQRKVFD    631 - 700
PVPVGVTKVILSTNIAETSITINDVVYVIDSCKQKVKLFTAHNNMTNYATVWASKTNLEQRKGRAGRVRP    701 - 770
GFCFHLCSRARFERLETHMTPEMFRTPLHEIALSIKLLRLGGIGQFLAKAIEPPPLDAVIEAEHTLRELD    771 - 840
ALDANDELTPLGRILAKLPIEPRFGKMMIMGCIFYVGDAICTIAAATCFPEPFINEGKRLGYIHRNFAGN    841 - 910
RFSDHVALLSVFQAWDDARMGGEEAEIRFCEHKRLNMATLRMTWEAKVQLKEILINSGFPEDCLLTQVFT    911 - 980
NTGPDNNLDVVISLLAFGVYPNVCYHKEKRKILTTEGRNALIHKSSVNCPFSSQDMKYPSPFFVFGEKIR    981 - 1050
TRAISAKGMTLVTPLQLLLFASKKVQSDGQIVLVDDWIKLQISHEAAACITGLRAAMEALVVEVTKQPAI   1051 - 1120
ISQLDPVNERMLNMIRQISRPSAAGINLMIGSTRYGDGPRPPKMARYDNGSGYRRGGSSYSGGGYGGGYS   1121 - 1190
SGGYGSGGYGGSANSFRAGYGAGVGGGYRGVSRGGFRGNSGGDYRGPSGGYRGSGGFQRGGGRGAYGTGY   1191 - 1260
FGQGRGGGGY                                                               1261 - 1270
//

Text Mined References (122)

PMID Year Title