Property Summary

NCBI Gene PubMed Count 30
PubMed Score 40.59
PubTator Score 45.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6234 3.3e-05
psoriasis 6685 1.3e-03
Multiple Sclerosis 498 9.2e-03
Disease Target Count Z-score Confidence
Melanoma 261 4.317 2.2

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.400 1.3e-03
medulloblastoma, large-cell -1.100 3.3e-05
Multiple Sclerosis 2.100 9.2e-03

Gene RIF (20)

PMID Text
25794939 This review briefly summarizes the RLR system, and focuses on the relationship between LGP2 and MDA5, describing in detail how these two proteins work together to detect foreign RNA and generate a fully functional antiviral response.
25288302 LGP2 did not reveal significant single-SNP associations with multiple sclerosis risk.
25127512 LGP2 increases the initial rate of MDA5-RNA interaction and regulates MDA5 filament assembly.
24829334 Experiments with paramyxovirus V protein-insensitive proteins revealed that the primary outcome of LGP2 interference is suppression of its ability to synergize with MDA5.
24550253 L region antisense RNA of EMCV is a key determinant of innate immunity to the virus and represents an RNA that activates LGP2 associated MDA5 in virally-infected cells.
23671710 Data show that LGP2 is able to synergize with melanoma differentiation associated gene-5 (mda-5) to render cells to induction by poly(I:C), but did not enhance retinoic acid-inducible gene-I (RIG-I) to induce type I interferon in response to poly(I:C).
23184951 results demonstrate previously unrecognized properties of LGP2 ATP hydrolysis and RNA interaction and provide a mechanistic basis for a positive regulatory role for LGP2 in antiviral signaling
22837208 LGP2, a host protein induced during influenza A virus infection, downregulates the host antiviral IFN response
22301134 Paramyxovirus 5 V proteins interact with the RNA Helicase LGP2 to inhibit RIG-I-dependent interferon beta induction.
22185736 the present study shows the presence of RIG-1,MDA-5, and LGP-2 in the human upper airways, most prominently inthe epithelium.
21525357 LGP2 functions as an inhibitor of the innate immune response triggered by Rabeis virus infection
21285412 Data sugget that DeltaPsi(m) and MAVS are coupled at the same stage in the RLR antiviral signaling pathway.
20331378 Observational study of gene-disease association. (HuGE Navigator)
19403670 The V protein interaction was found to disrupt ATP hydrolysis mediated by both MDA5 and LGP2.
19278996 The RIG-I-like receptor LGP2 recognizes the termini of double-stranded RNA.
18976975 Knockdown of DEXH (Asp-Glu-X-His) box polypeptide 58 (DHX58) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18411269 LGP2 can be coexpressed with RIG-I to inhibit activation of the NF-kappaB reporter expression and that LGP2 protein produced in insect cells can bind both single- and double-stranded RNA (dsRNA), with higher affinity and cooperativity for dsRNA.
17020950 LGP2 competes with the kinase IKKi for a common interaction site on IPS-1, as an element of negative-feedback regulation of intracellular antiviral signaling.
16116171 Shared and unique functions of the DExD/H-box helicases RIG-I, MDA5, and LGP2 in antiviral innate immunity.
11735219 Cloning and expression of the mouse Lpg2 mRNA, and comparison of the ORF to that of human LPG2 mRNA.

AA Sequence

MELRSYQWEVIMPALEGKNIIIWLPTGAGKTRAAAYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRM      1 - 70
LDGRWTVTTLSGDMGPRAGFGHLARCHDLLICTAELLQMALTSPEEEEHVELTVFSLIVVDECHHTHKDT     71 - 140
VYNVIMSQYLELKLQRAQPLPQVLGLTASPGTGGASKLDGAINHVLQLCANLDTWCIMSPQNCCPQLQEH    141 - 210
SQQPCKQYNLCHRRSQDPFGDLLKKLMDQIHDHLEMPELSRKFGTQMYEQQVVKLSEAAALAGLQEQRVY    211 - 280
ALHLRRYNDALLIHDTVRAVDALAALQDFYHREHVTKTQILCAERRLLALFDDRKNELAHLATHGPENPK    281 - 350
LEMLEKILQRQFSSSNSPRGIIFTRTRQSAHSLLLWLQQQQGLQTVDIRAQLLIGAGNSSQSTHMTQRDQ    351 - 420
QEVIQKFQDGTLNLLVATSVAEEGLDIPHCNVVVRYGLLTNEISMVQARGRARADQSVYAFVATEGSREL    421 - 490
KRELINEALETLMEQAVAAVQKMDQAEYQAKIRDLQQAALTKRAAQAAQRENQRQQFPVEHVQLLCINCM    491 - 560
VAVGHGSDLRKVEGTHHVNVNPNFSNYYNVSRDPVVINKVFKDWKPGGVISCRNCGEVWGLQMIYKSVKL    561 - 630
PVLKVRSMLLETPQGRIQAKKWSRVPFSVPDFDFLQHCAENLSDLSLD                          631 - 678
//

Text Mined References (39)

PMID Year Title
25794939 2015 LGP2 synergy with MDA5 in RLR-mediated RNA recognition and antiviral signaling.
25340845 2014 A novel function of human Pumilio proteins in cytoplasmic sensing of viral infection.
25288302 2014 Analysis of polymorphisms in RIG-I-like receptor genes in German multiple sclerosis patients.
25127512 2014 The innate immune sensor LGP2 activates antiviral signaling by regulating MDA5-RNA interaction and filament assembly.
24829334 2014 Paramyxovirus V protein interaction with the antiviral sensor LGP2 disrupts MDA5 signaling enhancement but is not relevant to LGP2-mediated RLR signaling inhibition.
24550253 2014 Identification of an LGP2-associated MDA5 agonist in picornavirus-infected cells.
23711367 2013 A role for the Ankyrin repeat containing protein Ankrd17 in Nod1- and Nod2-mediated inflammatory responses.
23671710 2013 LGP2 plays a critical role in sensitizing mda-5 to activation by double-stranded RNA.
23184951 2013 ATP hydrolysis enhances RNA recognition and antiviral signal transduction by the innate immune sensor, laboratory of genetics and physiology 2 (LGP2).
22837208 2012 LGP2 downregulates interferon production during infection with seasonal human influenza A viruses that activate interferon regulatory factor 3.
22301134 2012 Paramyxovirus V proteins interact with the RNA Helicase LGP2 to inhibit RIG-I-dependent interferon induction.
22185736 Retinoic acid-inducible gene 1-like receptors in the upper respiratory tract.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21791617 2011 DDX60, a DEXD/H box helicase, is a novel antiviral factor promoting RIG-I-like receptor-mediated signaling.
21616437 2011 Immune signaling by RIG-I-like receptors.
21525357 2011 Ambivalent role of the innate immune response in rabies virus pathogenesis.
21496944 2012 Sensing of viral nucleic acids by RIG-I: from translocation to translation.
21481967 2012 Regulation of RLR-mediated innate immune signaling--it is all about keeping the balance.
21285412 2011 Mitochondrial membrane potential is required for MAVS-mediated antiviral signaling.
21187438 2011 RIG-I/MDA5/MAVS are required to signal a protective IFN response in rotavirus-infected intestinal epithelium.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
19403670 2009 A shared interface mediates paramyxovirus interference with antiviral RNA helicases MDA5 and LGP2.
19380577 2009 Solution structures of cytosolic RNA sensor MDA5 and LGP2 C-terminal domains: identification of the RNA recognition loop in RIG-I-like receptors.
19278996 2009 The RIG-I-like receptor LGP2 recognizes the termini of double-stranded RNA.
19211564 2009 Regulation of signal transduction by enzymatically inactive antiviral RNA helicase proteins MDA5, RIG-I, and LGP2.
19208642 2009 The regulatory domain of the RIG-I family ATPase LGP2 senses double-stranded RNA.
18411269 2008 Structure and function of LGP2, a DEX(D/H) helicase that regulates the innate immunity response.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17473309 2007 Regulation of interferon production by RIG-I and LGP2: a lesson in self-control.
17190814 2007 Regulation of innate antiviral defenses through a shared repressor domain in RIG-I and LGP2.
17020950 2006 RNA- and virus-independent inhibition of antiviral signaling by RNA helicase LGP2.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16116171 2005 Shared and unique functions of the DExD/H-box helicases RIG-I, MDA5, and LGP2 in antiviral innate immunity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11735219 2001 The Stat3/5 locus encodes novel endoplasmic reticulum and helicase-like proteins that are preferentially expressed in normal and neoplastic mammary tissue.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.