Property Summary

NCBI Gene PubMed Count 30
PubMed Score 32.33
PubTator Score 29.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 1.300 1.1e-02
ependymoma 1.200 2.0e-02
oligodendroglioma 1.300 1.3e-02
permanent atrial fibrillation -1.100 7.2e-03
osteosarcoma 2.745 1.1e-09
juvenile dermatomyositis 1.345 5.4e-09
acute quadriplegic myopathy 1.733 7.6e-05
primary pancreatic ductal adenocarcinoma 1.854 2.0e-03
ovarian cancer 2.500 5.6e-06
pituitary cancer -1.400 1.9e-04
pancreatic cancer 1.800 6.1e-03

Gene RIF (14)

PMID Text
26740632 RHAU binds to an adenosine-rich region near the 3'-end of the long non-coding RNA BC200.
26172836 present a model showing that a replication fork disrupting a T-loop could create a 5' quadruplex with an opened 3'tail structure that is recognized by G4R1
24651521 we identify a novel function of DHX36 to facilitate viral RNA recognition
24151078 Used an integrated approach that includes small angle x-ray scattering, nuclear magnetic resonance spectroscopy, circular dichroism, and dynamic light scattering methods to demonstrate the recognition of G-quadruplexes by the N-terminal domain of RHAU.
22238380 Data supports a helicase function of RHAU on an intramolecular RNA quadruplex and show that the enzyme is capable of completely converting quadruplex RNA to a stable duplex.
22174317 HIV-1 Rev interacting protein, DEAH (Asp-Glu-Ala-His) box polypeptide 36 (DHX36), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with DHX36 is increased by RRE
21858080 Data show that hnRNPA1/A2, HuR and DAZAP1 splicing factors and DHX36 RNA helicase bind to the ISE, with hnRNPA1 acting negatively and DAZAP1 positively on splicing selection
21149580 The helicase domain of DHX36 does not mediate telomerase RNA (hTR) binding; instead, hTR interacts with the N-terminal accessory domain of DHX36 known to bind specifically to the parallel-strand G-quadruplex substrates resolved by the helicase domain.
20696886 DHX9/DHX36 represent the MyD88-dependent DNA sensors in the cytosol of plasmacytoid dendritic cells and suggest a much broader role for DHX helicases in viral sensing
20472641 The amino-terminal region of RHAU is essential for RHAU to bind G4 structures and within this region the evolutionary conserved RSM (RHAU-specific motif) domain is a major affinity and specificity determinant
18854321 RHAU is the fourth RNA helicase detected in SGs, after rck/p54, DDX3, and eIF4A, and its association with SGs is dynamic and mediated by an RHAU-specific RNA-binding domain
18842585 the RNA quadruplex resolving enzymatic activity associated with G4R1/RHAU and its exceptional binding affinity, suggesting a potential novel role for G4R1/RHAU in targeting in vivo RNA quadruplex structures
18279852 RHAU has a dual function, being involved in both the synthesis and degradation of mRNA in different subcellular compartments.
16150737 DHX36 protein is responsible for the majority of tetramolecular G4-DNA resolvase activity

AA Sequence

MSYDYHQNWGRDGGPRSSGGGYGGGPAGGHGGNRGSGGGGGGGGGGRGGRGRHPGHLKGREIGMWYAKKQ      1 - 70
GQKNKEAERQERAVVHMDERREEQIVQLLNSVQAKNDKESEAQISWFAPEDHGYGTEVSTKNTPCSENKL     71 - 140
DIQEKKLINQEKKMFRIRNRSYIDRDSEYLLQENEPDGTLDQKLLEDLQKKKNDLRYIEMQHFREKLPSY    141 - 210
GMQKELVNLIDNHQVTVISGETGCGKTTQVTQFILDNYIERGKGSACRIVCTQPRRISAISVAERVAAER    211 - 280
AESCGSGNSTGYQIRLQSRLPRKQGSILYCTTGIILQWLQSDPYLSSVSHIVLDEIHERNLQSDVLMTVV    281 - 350
KDLLNFRSDLKVILMSATLNAEKFSEYFGNCPMIHIPGFTFPVVEYLLEDVIEKIRYVPEQKEHRSQFKR    351 - 420
GFMQGHVNRQEKEEKEAIYKERWPDYVRELRRRYSASTVDVIEMMEDDKVDLNLIVALIRYIVLEEEDGA    421 - 490
ILVFLPGWDNISTLHDLLMSQVMFKSDKFLIIPLHSLMPTVNQTQVFKRTPPGVRKIVIATNIAETSITI    491 - 560
DDVVYVIDGGKIKETHFDTQNNISTMSAEWVSKANAKQRKGRAGRVQPGHCYHLYNGLRASLLDDYQLPE    561 - 630
ILRTPLEELCLQIKILRLGGIAYFLSRLMDPPSNEAVLLSIRHLMELNALDKQEELTPLGVHLARLPVEP    631 - 700
HIGKMILFGALFCCLDPVLTIAASLSFKDPFVIPLGKEKIADARRKELAKDTRSDHLTVVNAFEGWEEAR    701 - 770
RRGFRYEKDYCWEYFLSSNTLQMLHNMKGQFAEHLLGAGFVSSRNPKDPESNINSDNEKIIKAVICAGLY    771 - 840
PKVAKIRLNLGKKRKMVKVYTKTDGLVAVHPKSVNVEQTDFHYNWLIYHLKMRTSSIYLYDCTEVSPYCL    841 - 910
LFFGGDISIQKDNDQETIAVDEWIVFQSPARIAHLVKELRKELDILLQEKIESPHPVDWNDTKSRDCAVL    911 - 980
SAIIDLIKTQEKATPRNFPPRFQDGYYS                                              981 - 1008
//

Text Mined References (37)

PMID Year Title
26740632 2016 RNA Helicase Associated with AU-rich Element (RHAU/DHX36) Interacts with the 3'-Tail of the Long Non-coding RNA BC200 (BCYRN1).
26172836 2015 Mutational Dissection of Telomeric DNA Binding Requirements of G4 Resolvase 1 Shows that G4-Structure and Certain 3'-Tail Sequences Are Sufficient for Tight and Complete Binding.
24651521 2014 DHX36 enhances RIG-I signaling by facilitating PKR-mediated antiviral stress granule formation.
24151078 2013 Binding of G-quadruplexes to the N-terminal recognition domain of the RNA helicase associated with AU-rich element (RHAU).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22238380 2012 The RNA helicase RHAU (DHX36) unwinds a G4-quadruplex in human telomerase RNA and promotes the formation of the P1 helix template boundary.
21993297 2012 Yin Yang 1 contains G-quadruplex structures in its promoter and 5'-UTR and its expression is modulated by G4 resolvase 1.
21858080 2011 Interaction of hnRNPA1/A2 and DAZAP1 with an Alu-derived intronic splicing enhancer regulates ATM aberrant splicing.
21586581 2011 G4 resolvase 1 tightly binds and unwinds unimolecular G4-DNA.
21269460 2011 Initial characterization of the human central proteome.
21266579 2011 Raftlin is involved in the nucleocapture complex to induce poly(I:C)-mediated TLR3 activation.
21149580 2011 The 5' guanosine tracts of human telomerase RNA are recognized by the G-quadruplex binding domain of the RNA helicase DHX36 and function to increase RNA accumulation.
20696886 2010 Aspartate-glutamate-alanine-histidine box motif (DEAH)/RNA helicase A helicases sense microbial DNA in human plasmacytoid dendritic cells.
20472641 2010 Role of the amino terminal RHAU-specific motif in the recognition and resolution of guanine quadruplex-RNA by the DEAH-box RNA helicase RHAU.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18854321 2008 Recruitment of the RNA helicase RHAU to stress granules via a unique RNA-binding domain.
18842585 2008 G4 resolvase 1 binds both DNA and RNA tetramolecular quadruplex with high affinity and is the major source of tetramolecular quadruplex G4-DNA and G4-RNA resolving activity in HeLa cell lysates.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
18279852 2008 Transcription-dependent nucleolar cap localization and possible nuclear function of DExH RNA helicase RHAU.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17932509 2007 Proteomic and functional analysis of Argonaute-containing mRNA-protein complexes in human cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16482509 2006 Binding specificity of Toll-like receptor cytoplasmic domains.
16150737 2005 The DEXH protein product of the DHX36 gene is the major source of tetramolecular quadruplex G4-DNA resolving activity in HeLa cell lysates.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14731398 2004 Facilitation of mRNA deadenylation and decay by the exosome-bound, DExH protein RHAU.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12812084 2003 Expression research for human DDX36 and mouse Ddx36 gene in the adult testis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12198572 2002 Molecular cloning and characterization of human DDX36 and mouse Ddx36 genes, new members of the DEAD/H box superfamily.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.