Property Summary

NCBI Gene PubMed Count 12
PubMed Score 9.14
PubTator Score 10.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 3.4e-04
subependymal giant cell astrocytoma 2287 1.6e-02

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.200 3.4e-04
subependymal giant cell astrocytoma 1.521 1.6e-02

Gene RIF (6)

PMID Text
19161603 DHX32 may play an important role in the development of colorectal cancer and could serve as a novel biomarker for colorectal cancer after additional investigation.
17352256 In peripheral blood lymphocytes, a correlation between DHX32 and c-FLIP short expression was detected in response to different T-cell activation stimuli. Results suggest DHX32 involvement in regulating T-cell response to apoptotic stimuli.
17174952 dysregulated expression of DHX32 might lead to as of yet unknown changes in mitochondrial homeostasis manifested by cytoplasmic redistribution of the molecular chaperon Hsp60
16959245 These results suggest that DHX32 is a putative RNA helicase that might be involved in regulating nuclear and mitochondrial gene expression.
16414036 cloned DHX32 proximal promoter and identified a 218bp fragment containing two potential binding sites for the transcription factor nuclear factor of activated T cells (NF-AT)
12163057 Structural characterization and expression of the DDX32 gene. Expression studies show that DDX32 is widespread but specifically down-regulated in acute lymphoblastic leukemias and might play a role in normal and/or abnormal lymphopoiesis.

AA Sequence

MEEEGLECPNSSSEKRYFPESLDSSDGDEEEVLACEDLELNPFDGLPYSSRYYKLLKEREDLPIWKEKYS      1 - 70
FMENLLQNQIVIVSGDAKCGKSAQVPQWCAEYCLSIHYQHGGVICTQVHKQTVVQLALRVADEMDVNIGH     71 - 140
EVGYVIPFENCCTNETILRYCTDDMLQREMMSNPFLGSYGVIILDDIHERSIATDVLLGLLKDVLLARPE    141 - 210
LKLIINSSPHLISKLNSYYGNVPVIEVKNKHPVEVVYLSEAQKDSFESILRLIFEIHHSGEKGDIVVFLA    211 - 280
CEQDIEKVCETVYQGSNLNPDLGELVVVPLYPKEKCSLFKPLDETEKRCQVYQRRVVLTTSSGEFLIWSN    281 - 350
SVRFVIDVGVERRKVYNPRIRANSLVMQPISQSQAEIRKQILGSSSSGKFFCLYTEEFASKDMTPLKPAE    351 - 420
MQEANLTSMVLFMKRIDIAGLGHCDFMNRPAPESLMQALEDLDYLAALDNDGNLSEFGIIMSEFPLDPQL    421 - 490
SKSILASCEFDCVDEVLTIAAMVTAPNCFSHVPHGAEEAALTCWKTFLHPEGDHFTLISIYKAYQDTTLN    491 - 560
SSSEYCVEKWCRDYFLNCSALRMADVIRAELLEIIKRIELPYAEPAFGSKENTLNIKKALLSGYFMQIAR    561 - 630
DVDGSGNYLMLTHKQVAQLHPLSGYSITKKMPEWVLFHKFSISENNYIRITSEISPELFMQLVPQYYFSN    631 - 700
LPPSESKDILQQVVDHLSPVSTMNKEQQMCETCPETEQRCTLQ                               701 - 743
//

Text Mined References (18)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
19161603 2009 Up-regulation and clinical relevance of novel helicase homologue DHX32 in colorectal cancer.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17352256 A role for DHX32 in regulating T-cell apoptosis.
17174952 2007 Altered distribution of heat shock protein 60 (Hsp60) with dysregulated expression of DHX32.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16959245 2006 Nuclear and mitochondrial localization of the putative RNA helicase DHX32.
16414036 2005 The activation-induced expression of DHX32 in Jurkat T cells is specific and involves calcium and nuclear factor of activated T cells.
16181624 2005 Expression of DHX32 in lymphoid tissues.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12527204 2003 Genomic structure of the human BCCIP gene and its expression in cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12163057 2002 The novel helicase homologue DDX32 is down-regulated in acute lymphoblastic leukemia.
11313963 2001 Inhibition of breast and brain cancer cell growth by BCCIPalpha, an evolutionarily conserved nuclear protein that interacts with BRCA2.