Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.41
PubTator Score 1.63

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
acute quadriplegic myopathy -2.136 4.4e-08
autosomal dominant Emery-Dreifuss muscul... -1.468 1.0e-04
Duchenne muscular dystrophy -1.070 1.4e-06
juvenile dermatomyositis -1.004 2.4e-08

Gene RIF (1)

AA Sequence

MGVMAMLMLPLLLLGISGLLFIYQEVSRLWSKSAVQNKVVVITDAISGLGKECARVFHTGGARLVLCGKN      1 - 70
WERLENLYDALISVADPSKQTFTPKLVLLDLSDISCVPDVAKEVLDCYGCVDILINNASVKVKGPAHKIS     71 - 140
LELDKKIMDANYFGPITLTKALLPNMISRRTGQIVLVNNIQGKFGIPFRTTYAASKHAALGFFDCLRAEV    141 - 210
EEYDVVISTVSPTFIRSYHVYPEQGNWEASIWKFFFRKLTYGVHPVEVAEEVMRTVRRKKQEVFMANPIP    211 - 280
KAAVYVRTFFPEFFFAVVACGVKEKLNVPEEG                                          281 - 312
//

Text Mined References (5)

PMID Year Title