Property Summary

NCBI Gene PubMed Count 16
PubMed Score 13.24
PubTator Score 18.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -7.600 4.7e-09
osteosarcoma -1.145 4.5e-02
astrocytoma 1.200 4.8e-02
medulloblastoma, large-cell -1.200 2.3e-04
tuberculosis -2.100 1.3e-06
lung cancer -1.300 2.2e-03
breast carcinoma -1.600 3.6e-04
fibroadenoma -1.900 4.8e-03
interstitial cystitis -1.300 1.3e-04
pilocytic astrocytoma 1.100 2.3e-04
posterior fossa group B ependymoma 1.300 9.7e-07
subependymal giant cell astrocytoma 1.214 8.5e-03
lung carcinoma -1.600 1.1e-13
spina bifida 1.207 4.3e-02
ductal carcinoma in situ -1.500 3.5e-04
invasive ductal carcinoma -1.100 9.3e-03
ovarian cancer 1.300 2.2e-04
pituitary cancer -1.900 1.4e-08

Synonym

Accession O75911 B2R7F3 Q5VUY3 Q6UY38 Q9BUC8
Symbols SDR1
RDH17
Rsdr1
DD83.1
SDR16C1
retSDR1

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (5)

PMID Text
24733397 Data indicate that retinaldehyde reductase (DHRS3) requires retinol dehydrogenase 10 (RDH10) for full enzymatic activity and, in turn, activates RDH10.
21659514 p53-Inducible DHRS3 is an endoplasmic reticulum protein associated with lipid droplet accumulation.
20543567 The retSDR1 is identified as novel transcriptional target of the p53 family and not transactivated by EEC syndrome-specific mutations of TAp63gamma.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676742 CST6, CXCL14, DHRS3, and SPP1 are regulated by BRAF signaling and may play a role in papillary thyroid carcinoma pathogenesis

AA Sequence

MVWKRLGALVMFPLQMIYLVVKAAVGLVLPAKLRDLSRENVLITGGGRGIGRQLAREFAERGARKIVLWG      1 - 70
RTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITILVNNAAVVHGKSLMDSDDDAL     71 - 140
LKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALSAIPGAIDYCTSKASAFAFMESLTLGLLDCP    141 - 210
GVSATTVLPFHTSTEMFQGMRVRFPNLFPPLKPETVARRTVEAVQLNQALLLLPWTMHALVILKSILPQA    211 - 280
ALEEIHKFSGTYTCMNTFKGRT                                                    281 - 302
//

Text Mined References (19)

PMID Year Title
24733397 2014 The retinaldehyde reductase activity of DHRS3 is reciprocally activated by retinol dehydrogenase 10 to control retinoid homeostasis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21659514 2011 p53-Inducible DHRS3 is an endoplasmic reticulum protein associated with lipid droplet accumulation.
20543567 2010 The retinal dehydrogenase/reductase retSDR1/DHRS3 gene is activated by p53 and p63 but not by mutants derived from tumors or EEC/ADULT malformation syndromes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
18676742 2008 Gene expression profiling of papillary thyroid carcinoma identifies transcripts correlated with BRAF mutational status and lymph node metastasis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17286855 2007 Mapping of transcription start sites of human retina expressed genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226107 2002 Dual-substrate specificity short chain retinol dehydrogenases from the vertebrate retina.
11861404 2002 retSDR1, a short-chain retinol dehydrogenase/reductase, is retinoic acid-inducible and frequently deleted in human neuroblastoma cell lines.
10800688 2000 Short-chain dehydrogenases/reductases in retina.
9705317 1998 Molecular characterization of a novel short-chain dehydrogenase/reductase that reduces all-trans-retinal.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.