Property Summary

NCBI Gene PubMed Count 18
PubMed Score 14.73
PubTator Score 18.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytoma 1.200 4.8e-02
Astrocytoma, Pilocytic 1.100 3.3e-04
breast carcinoma -1.600 3.6e-04
ductal carcinoma in situ -1.500 3.5e-04
fibroadenoma -1.900 4.8e-03
interstitial cystitis -1.100 4.0e-03
invasive ductal carcinoma -1.100 9.3e-03
lung cancer -1.300 2.2e-03
lung carcinoma -1.600 1.1e-13
malignant mesothelioma -7.600 4.7e-09
medulloblastoma, large-cell -1.200 2.3e-04
osteosarcoma -1.145 4.5e-02
ovarian cancer 1.300 2.2e-04
pituitary cancer -1.900 1.4e-08
posterior fossa group A ependymoma 1.100 3.8e-05
spina bifida 1.207 4.3e-02
subependymal giant cell astrocytoma 1.214 8.5e-03
tuberculosis -2.100 1.3e-06

 GWAS Trait (1)

Gene RIF (7)

AA Sequence

MVWKRLGALVMFPLQMIYLVVKAAVGLVLPAKLRDLSRENVLITGGGRGIGRQLAREFAERGARKIVLWG      1 - 70
RTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITILVNNAAVVHGKSLMDSDDDAL     71 - 140
LKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALSAIPGAIDYCTSKASAFAFMESLTLGLLDCP    141 - 210
GVSATTVLPFHTSTEMFQGMRVRFPNLFPPLKPETVARRTVEAVQLNQALLLLPWTMHALVILKSILPQA    211 - 280
ALEEIHKFSGTYTCMNTFKGRT                                                    281 - 302
//

Text Mined References (21)

PMID Year Title