Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.67

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MSLYRSVVWFAKGLREYTKSGYESACKDFVPHDLEVQIPGRVFLVTGGNSGIGKATALEIAKRGGTVHLV      1 - 70
CRDQAPAEDARGEIIRESGNQNIFLHIVDLSDPKQIWKFVENFKQEHKLHVLINNAGCMVNKRELTEDGL     71 - 140
EKNFAANTLGVYILTTGLIPVLEKEHDPRVITVSSGGMLVQKLNTNDLQSERTPFDGTMVYAQNKRQQVV    141 - 210
LTERWAQGHPAIHFSSMHPGWADTPGVRQAMPGFHARFGDRLRSEAQGADTMLWLALSSAAAAQPSGRFF    211 - 280
QDRKPVSTHLPLATASSSPAEEEKLIEILEQLAQTFK                                     281 - 317
//

Text Mined References (6)

PMID Year Title