Property Summary

NCBI Gene PubMed Count 17
PubMed Score 0.43
PubTator Score 1.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (8)

Disease log2 FC p
adrenocortical carcinoma -1.041 1.0e-04
Astrocytoma, Pilocytic 1.100 7.5e-08
esophageal adenocarcinoma -2.000 1.8e-02
malignant mesothelioma -2.500 5.6e-08
osteosarcoma -1.354 3.7e-03
ovarian cancer 1.400 1.2e-04
psoriasis 1.700 1.4e-04
X-linked cerebral adrenoleukodystrophy -1.100 2.7e-02

Gene RIF (3)

AA Sequence

MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESE      1 - 70
VRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVP     71 - 140
AGQGLIVVISSPGSLQYMFNVPYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEV    141 - 210
LQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSS    211 - 280
VLSHVSGLGWLASYLPSFLRVPKWIIALYTSKF                                         281 - 313
//

Text Mined References (21)

PMID Year Title