Property Summary

NCBI Gene PubMed Count 36
PubMed Score 85.42
PubTator Score 170.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.036 1.8e-02
psoriasis -1.100 7.8e-04
osteosarcoma -1.457 2.1e-06
pancreatic ductal adenocarcinoma liver m... -1.125 4.2e-03
diabetes mellitus -1.400 1.4e-03
subependymal giant cell astrocytoma -1.707 5.0e-03
acute myeloid leukemia -1.100 3.3e-02

Protein-protein Interaction (3)

Gene RIF (8)

PMID Text
25511211 Whereas, dhps mutation study revealed that triple mutant haplotype AGEAA (S436A+A437G+K540E) associated with Sulphadoxine resistance was found among 26% of P. falciparum field isolates.
22927971 eIF-5A as well as the hypusine-forming enzymes deoxyhypusine synthase (DHS) and deoxyhypusine hydroxylase (DOHH) are highly overexpressed in glioblastoma patient sample
22491477 DHPS and WDR83 were capable of forming an RNA duplex at overlapping 3' untranslated regions and this duplex increased their mutual stability, which was required for the bidirectional regulation.
20439316 A novel series of cell movements that orient the polarity of Lrp12/Mig13a-expressing neurons and their axons just prior to cortical plate assembly do not occur in reeler mutant mice.
19055622 Dhps-437 and dhps-540 are strongly associated with SP treatment failure and should be evaluated further as a method for surveillance of SP-based therapy in DRC.
15100216 crystal structure of deoxyhypusine synthase reveals the configuration of the active enzyme and of an enzyme.NAD.inhibitor ternary complex
14749535 deoxyhypusine synthase and its phosphorylation modification may have other independent cellular functions because of versatile roles of deoxyhypusine synthase
12788913 deoxyhypusine synthase has a role in generating spermidine or homospermidine

AA Sequence

MEGSLEREAPAGALAAVLKHSSTLPPESTQVRGYDFNRGVNYRALLEAFGTTGFQATNFGRAVQQVNAMI      1 - 70
EKKLEPLSQDEDQHADLTQSRRPLTSCTIFLGYTSNLISSGIRETIRYLVQHNMVDVLVTTAGGVEEDLI     71 - 140
KCLAPTYLGEFSLRGKELRENGINRIGNLLVPNENYCKFEDWLMPILDQMVMEQNTEGVKWTPSKMIARL    141 - 210
GKEINNPESVYYWAQKNHIPVFSPALTDGSLGDMIFFHSYKNPGLVLDIVEDLRLINTQAIFAKCTGMII    211 - 280
LGGGVVKHHIANANLMRNGADYAVYINTAQEFDGSDSGARPDEAVSWGKIRVDAQPVKVYADASLVFPLL    281 - 350
VAETFAQKMDAFMHEKNED                                                       351 - 369
//

Text Mined References (43)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25511211 Genetic polymorphisms associated with sulphadoxine-pyrimethamine drug resistance among Plasmodium falciparum field isolates in malaria endemic areas of Assam.
25416956 2014 A proteome-scale map of the human interactome network.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23525104 2013 Allosteric activation of trypanosomatid deoxyhypusine synthase by a catalytically dead paralog.
22927971 2012 Expression of eukaryotic initiation factor 5A and hypusine forming enzymes in glioblastoma patient samples: implications for new targeted therapies.
22491477 2012 Bidirectional regulation between WDR83 and its natural antisense transcript DHPS in gastric cancer.
21269460 2011 Initial characterization of the human central proteome.
20439316 2011 Lrp12/Mig13a reveals changing patterns of preplate neuronal polarity during corticogenesis that are absent in reeler mutant mice.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19997760 2010 Functional significance of eIF5A and its hypusine modification in eukaryotes.
19060904 2009 An empirical framework for binary interactome mapping.
19055622 2008 dhfr and dhps genotype and sulfadoxine-pyrimethamine treatment failure in children with falciparum malaria in the Democratic Republic of Congo.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17476569 2007 Posttranslational synthesis of hypusine: evolutionary progression and specificity of the hypusine modification.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16452303 2006 The post-translational synthesis of a polyamine-derived amino acid, hypusine, in the eukaryotic translation initiation factor 5A (eIF5A).
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15100216 2004 A new crystal structure of deoxyhypusine synthase reveals the configuration of the active enzyme and of an enzyme.NAD.inhibitor ternary complex.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14749535 2003 Protein kinase CK2 phosphorylates and interacts with deoxyhypusine synthase in HeLa cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14622290 2003 Identification and characterization of eukaryotic initiation factor 5A-2.
12788913 2003 Reversal of the deoxyhypusine synthesis reaction. Generation of spermidine or homospermidine from deoxyhypusine by deoxyhypusine synthase.
12562768 2003 Molecular evolution by change of function. Alkaloid-specific homospermidine synthase retained all properties of deoxyhypusine synthase except binding the eIF5A precursor protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11311149 2001 Structure-function studies of human deoxyhypusine synthase: identification of amino acid residues critical for the binding of spermidine and NAD.
10229683 1999 Complex formation between deoxyhypusine synthase and its protein substrate, the eukaryotic translation initiation factor 5A (eIF5A) precursor.
9666110 1998 Localization and genomic structure of human deoxyhypusine synthase gene on chromosome 19p13.2-distal 19p13.1.
9493264 1998 Crystal structure of the NAD complex of human deoxyhypusine synthase: an enzyme with a ball-and-chain mechanism for blocking the active site.
9405486 1997 Enzyme-substrate intermediate at a specific lysine residue is required for deoxyhypusine synthesis. The role of Lys329 in human deoxyhypusine synthase.
9110174 1997 Large-scale concatenation cDNA sequencing.
8812510 1996 The gene coding for human deoxyhypusine synthase (DHPS) maps to chromosome 19p13.11-p13.12.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8615810 1996 Molecular cloning and functional expression of human deoxyhypusine synthase cDNA based on expressed sequence tag information.
8549832 1996 Molecular characterization of a cDNA encoding functional human deoxyhypusine synthase and chromosomal mapping of the corresponding gene locus.
7929297 1994 Structural features of the eIF-5A precursor required for posttranslational synthesis of deoxyhypusine.
7750572 1995 Purification and characterization of human deoxyhypusine synthase from HeLa cells.
7673224 1995 Cloning and expression of human deoxyhypusine synthase cDNA. Structure-function studies with the recombinant enzyme and mutant proteins.