Property Summary

NCBI Gene PubMed Count 30
PubMed Score 283.23
PubTator Score 117.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 2.300 4.3e-07
psoriasis -2.300 1.0e-05
osteosarcoma -2.435 1.8e-07
pancreatic ductal adenocarcinoma liver m... -2.146 1.4e-03

Gene RIF (16)

PMID Text
26086954 This is the first study to report on conformational changes of the HsDHODH N-terminal microdomain through a combination of CD and DEER spectroscopic techniques
23216091 Considering that pyrimidine deficiency alone does not induce craniofacial dysmorphism, the DHODH mutations may contribute to the Miller syndrome in part through somehow altered mitochondrial function.
22967083 The G202A and R346W mutation causes deficient protein stability, and the R135C mutation impairs the substrate-induced enzymatic activity, suggesting that impairment of DHODH activity is linked to the Miller syndrome phenotype.
22966891 Carriage of a six-marker DHODH haplotype was associated with a reduced treatment response (p = 0.008).
22692683 biallelic DHODH mutations in four unrelated families with typical clinical features of Miller syndrome.
21430780 DHODH inhibition led to a marked decrease in melanoma growth both in vitro and in xenograft studies
20877624 Observational study of gene-disease association. (HuGE Navigator)
20399851 required for N-(4-hydroxyphenyl)retinamide-induced reactive oxygen species production and apoptosis of cancer epithelial cells
20220176 DHODH recessively causes Miller syndrome.
19915526 Data confirmed the presence of DHODH mutations in families with Miller syndrome.
19605743 we report a new association of DHODH A40C polymorphism with leflunomide toxicity in patients with Rheumatoid Arthritis.
19605743 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19207032 DHODH polymorphism may be associated with incireased remiaaion in leflunomide treatment in rheumatoid arthritis patients.
19207032 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18672895 Data provide new insights into the dynamic features of the DHODH reaction and suggest new approaches to the design of inhibitors against DHODH.
17004840 biophysical analysis of hydrogen bonding pathways in human dihydroorotate dehydrogenase

AA Sequence

MAWRHLKKRAQDAVIILGGGGLLFASYLMATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRA      1 - 70
RFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQ     71 - 140
AVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVV    141 - 210
NVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLI    211 - 280
VTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGAS    281 - 350
LVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR                             351 - 395
//

Text Mined References (34)

PMID Year Title
26086954 2015 Conformational changes of the HsDHODH N-terminal Microdomain via DEER Spectroscopy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23216091 2013 Dihydro-orotate dehydrogenase is physically associated with the respiratory complex and its loss leads to mitochondrial dysfunction.
22967083 2012 Protein instability and functional defects caused by mutations of dihydro-orotate dehydrogenase in Miller syndrome patients.
22966891 2012 Association of DHODH haplotype variants and response to leflunomide treatment in rheumatoid arthritis.
22692683 2012 Miller (Genee-Wiedemann) syndrome represents a clinically and biochemically distinct subgroup of postaxial acrofacial dysostosis associated with partial deficiency of DHODH.
21430780 2011 DHODH modulates transcriptional elongation in the neural crest and melanoma.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20399851 2010 Dihydroorotate dehydrogenase is required for N-(4-hydroxyphenyl)retinamide-induced reactive oxygen species production and apoptosis.
20220176 2010 Analysis of genetic inheritance in a family quartet by whole-genome sequencing.
19915526 2010 Exome sequencing identifies the cause of a mendelian disorder.
19605743 2009 Dihydroorotate dehydrogenase polymorphism influences the toxicity of leflunomide treatment in patients with rheumatoid arthritis.
19207032 2009 The effect of exon (19C>A) dihydroorotate dehydrogenase gene polymorphism on rheumatoid arthritis treatment with leflunomide.
18951430 2008 Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre ADHD genetics study.
18672895 2008 The structures of human dihydroorotate dehydrogenase with and without inhibitor reveal conformational flexibility in the inhibitor and substrate binding sites.
17004840 2006 Hydrogen bonding pathways in human dihydroorotate dehydrogenase.
16480261 2006 Dual binding mode of a novel series of DHODH inhibitors.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12052230 2002 Detection and location of the enzymes of de novo pyrimidine biosynthesis in mammalian spermatozoa.
11248707 2001 Recombinant expression of N-terminal truncated mutants of the membrane bound mouse, rat and human flavoenzyme dihydroorotate dehydrogenase. A versatile tool to rate inhibitor effects?
11012787 2000 Immunocytochemical detection of mitochondrial dihydroorotate dehydrogenase in human spermatozoa.
10727948 2000 Requirements for the mitochondrial import and localization of dihydroorotate dehydrogenase.
10673429 2000 Structures of human dihydroorotate dehydrogenase in complex with antiproliferative agents.
9693067 1998 Expression, purification, and characterization of histidine-tagged rat and human flavoenzyme dihydroorotate dehydrogenase.
8925840 1996 Functional expression of a fragment of human dihydroorotate dehydrogenase by means of the baculovirus expression vector system, and kinetic investigation of the purified recombinant enzyme.
8211381 1993 Regional mapping of the gene encoding dihydroorotate dehydrogenase, an enzyme involved in UMP synthesis, electron transport, and superoxide generation, to human chromosome region 16q22.
7487077 1995 Recombinant human dihydroorotate dehydrogenase: expression, purification, and characterization of a catalytically functional truncated enzyme.
1446837 1992 Cloning and sequencing of a human cDNA coding for dihydroorotate dehydrogenase by complementation of the corresponding yeast mutant.