Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.93
PubTator Score 4.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
gastric cancer 1.700 2.9e-03
hepatocellular carcinoma 1.900 3.0e-05
pancreatic cancer 1.600 9.9e-03
osteosarcoma -1.276 8.5e-03
cystic fibrosis 1.045 1.6e-03
tuberculosis and treatment for 6 months -1.900 6.1e-06
intraductal papillary-mucinous carcinoma... 1.300 4.7e-03
pancreatic carcinoma 1.600 9.9e-03
ovarian cancer -1.400 6.3e-06

Gene RIF (3)

PMID Text
24122410 We hope this work will be useful to understand the general characteristics of DHFRL1.
21876184 The DHFRP4, or dihydrofolate reductase-like 1 (DHFRL1), gene is expressed and shares some commonalities with DHFR.
18447718 The results of this study suggest that genetic variants of methionine metabolism are associated with meningioma formation

AA Sequence

MFLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKD      1 - 70
RINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSSVYKEAMNHLGHLKLFVTRIM     71 - 140
QDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKFEVCEKDD                           141 - 187
//

Text Mined References (10)

PMID Year Title
25980602 2015 An active second dihydrofolate reductase enzyme is not a feature of rat and mouse, but they do have activity in their mitochondria.
24122410 2013 Insight into the molecular mechanism about lowered dihydrofolate binding affinity to dihydrofolate reductase-like 1 (DHFRL1).
21876188 2011 Identification of a de novo thymidylate biosynthesis pathway in mammalian mitochondria.
21876184 2011 The former annotated human pseudogene dihydrofolate reductase-like 1 (DHFRL1) is expressed and functional.
18447718 2008 Polymorphisms of methionine metabolism and susceptibility to meningioma formation: laboratory investigation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.