Property Summary

NCBI Gene PubMed Count 38
PubMed Score 85.18
PubTator Score 22.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.450 2.6e-04
group 3 medulloblastoma -1.600 4.0e-03
posterior fossa group B ependymoma -1.200 1.3e-05

Protein-protein Interaction (6)

Gene RIF (20)

PMID Text
25921290 Redundant and specialized roles for diacylglycerol kinases alpha and zeta in the control of T cell functions.
25450975 This study shows that DGKzeta knockdown facilitates degradation of IkappaB, followed by nuclear translocation of NF-kappaB p65 subunit.
24646293 Elevated DGKzeta expression contributes to increased Rho GTPase activation and the enhanced motility of metastatic cancer cells.
23723068 Data indicate that after P2Y6 receptor stimulation both phospholipase D (PLD) and DGKzeta enzymes are responsible for producing phosphatidic acid (PA).
22895365 DGK regulates melanogenesis via modulation of the posttranslational processing of tyrosinase, which may be related with the protein degradation machinery.
22271650 Antigen-specific CD8-positive T cells from DGKzeta-deficient transgenic mice show enhanced expansion and increased cytokine production after lymphocytic choriomeningitis virus infection, yet DGK-deficient memory CD8+ T cells exhibit impaired expansion.
21996351 Nucleosome assembly protein (NAP) 1-like 1 (NAP1L1) and NAP1-like 4 (NAP1L4) are identified as novel DGKzeta binding partners.
21937721 DGK-zeta translocated rapidly to the plasma membrane at early stages of immunological synapse (IS) formation independent of enzyme activity; study highlights a DGKzeta-specific function for local diacylglycerol metabolism at the IS and offers new clues to its mode of regulation
21194521 Data show that Diacylglycerol that 2-arachidonoyl glycerol is a very poor substrate for either the epsilon or the zeta isoforms of diacylglycerol kinases.
19308020 None of SNPs of diacylglycerol kinase zeta tested showed association with bipolar disorder in Sardinian sample.
19211846 In DGKzeta-deficient fibroblasts PAK1 phosphorylation and Rac1-RhoGDI dissociation were attenuated, leading to reduced Rac1 activation after platelet-derived growth factor stimulation.
18694729 PKD activation is induced by DGKzeta, suggesting DGK is an upstream regulator of oxidative stress-induced activation of the PKD signaling pathway in intestinal epithelial cells.
18004883 2,3-dioleoylglycerol binds to a site on the alpha and zeta isoforms of diacylglycerol kinase that is exposed as a consequence of the substrate binding to the active site.
16286473 DGKzeta may act in vivo as a downstream effector of pRB to regulate nuclear levels of diacylglycerol and phosphatidic acid
15632115 DGKzeta-derived phosphatidic acid acts as a mediator of mTOR signaling
15157668 DGKzeta generating PA, stimulates PIP5KIalpha activity to increase local PIP2, which regulates actin polymerization.
14707140 role in controlling the induction of luteinizing hormone beta transcription by ERK1/2
12890670 PKC alpha phosphorylates diacylglycerol kinase zeta in cells, and this phosphorylation inhibits its kinase activity to remove cellular diacylglycerol, thereby affecting cell growth.
12070163 Negative regulation of T cell receptor induced activation of the Ras-Erk1/2-AP1 pathway by DGKz
12015310 structural domain requirements for translocation and activity

AA Sequence

METFFRRHFRGKVPGPGEGQQRPSSVGLPTGKARRRSPAGQASSSLAQRRRSSAQLQGCLLSCGVRAQGS      1 - 70
SRRRSSTVPPSCNPRFIVDKVLTPQPTTVGAQLLGAPLLLTGLVGMNEEEGVQEDVVAEASSAIQPGTKT     71 - 140
PGPPPPRGAQPLLPLPRYLRRASSHLLPADAVYDHALWGLHGYYRRLSQRRPSGQHPGPGGRRASGTTAG    141 - 210
TMLPTRVRPLSRRRQVALRRKAAGPQAWSALLAKAITKSGLQHLAPPPPTPGAPCSESERQIRSTVDWSE    211 - 280
SATYGEHIWFETNVSGDFCYVGEQYCVARMLKSVSRRKCAACKIVVHTPCIEQLEKINFRCKPSFRESGS    281 - 350
RNVREPTFVRHHWVHRRRQDGKCRHCGKGFQQKFTFHSKEIVAISCSWCKQAYHSKVSCFMLQQIEEPCS    351 - 420
LGVHAAVVIPPTWILRARRPQNTLKASKKKKRASFKRKSSKKGPEEGRWRPFIIRPTPSPLMKPLLVFVN    421 - 490
PKSGGNQGAKIIQSFLWYLNPRQVFDLSQGGPKEALEMYRKVHNLRILACGGDGTVGWILSTLDQLRLKP    491 - 560
PPPVAILPLGTGNDLARTLNWGGGYTDEPVSKILSHVEEGNVVQLDRWDLHAEPNPEAGPEDRDEGATDR    561 - 630
LPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGTAFSDFLMGSSKDLAKHIRVVCDGM    631 - 700
DLTPKIQDLKPQCVVFLNIPRYCAGTMPWGHPGEHHDFEPQRHDDGYLEVIGFTMTSLAALQVGGHGERL    701 - 770
TQCREVVLTTSKAIPVQVDGEPCKLAASRIRIALRNQATMVQKAKRRSAAPLHSDQQPVPEQLRIQVSRV    771 - 840
SMHDYEALHYDKEQLKEASVPLGTVVVPGDSDLELCRAHIERLQQEPDGAGAKSPTCQKLSPKWCFLDAT    841 - 910
TASRFYRIDRAQEHLNYVTEIAQDEIYILDPELLGASARPDLPTPTSPLPTSPCSPTPRSLQGDAAPPQG    911 - 980
EELIEAAKRNDFCKLQELHRAGGDLMHRDEQSRTLLHHAVSTGSKDVVRYLLDHAPPEILDAVEENGETC    981 - 1050
LHQAAALGQRTICHYIVEAGASLMKTDQQGDTPRQRAEKAQDTELAAYLENRQHYQMIQREDQETAV      1051 - 1117
//

Text Mined References (42)

PMID Year Title
25921290 2015 Redundant and specialized roles for diacylglycerol kinases ? and ? in the control of T cell functions.
25450975 2015 Downregulation of diacylglycerol kinase ? enhances activation of cytokine-induced NF-?B signaling pathway.
24646293 2014 Increased diacylglycerol kinase ? expression in human metastatic colon cancer cells augments Rho GTPase activity and contributes to enhanced invasion.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23723068 2013 Regulation of phospholipase D activity and phosphatidic acid production after purinergic (P2Y6) receptor stimulation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22895365 2012 Diacylglycerol kinase regulates tyrosinase expression and function in human melanocytes.
22627129 2012 Biosynthesis of alkyl lysophosphatidic acid by diacylglycerol kinases.
22271650 2012 Differential regulation of primary and memory CD8 T cell immune responses by diacylglycerol kinases.
21996351 2011 Interaction of nucleosome assembly proteins abolishes nuclear localization of DGK? by attenuating its association with importins.
21937721 2011 Diacylglycerol kinase ? controls diacylglycerol metabolism at the immunological synapse.
21194521 2011 Endocannabinoids and diacylglycerol kinase activity.
20694011 2010 Association of IFIH1 and other autoimmunity risk alleles with selective IgA deficiency.
19308020 2009 The diacylglycerol kinase eta gene and bipolar disorder: a replication study in a Sardinian sample.
19211846 2009 Diacylglycerol kinase zeta regulates actin cytoskeleton reorganization through dissociation of Rac1 from RhoGDI.
18694729 2008 Diacylglycerol kinase regulation of protein kinase D during oxidative stress-induced intestinal cell injury.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18004883 2007 Substrate chirality and specificity of diacylglycerol kinases and the multisubstrate lipid kinase.
17664281 2007 Cyclic AMP-stimulated interaction between steroidogenic factor 1 and diacylglycerol kinase theta facilitates induction of CYP17.
17351151 2007 Proteomics identification of sorting nexin 27 as a diacylglycerol kinase zeta-associated protein: new diacylglycerol kinase roles in endocytic recycling.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16286473 2006 The retinoblastoma family proteins bind to and activate diacylglycerol kinase zeta.
15632115 2005 Modulation of the mammalian target of rapamycin pathway by diacylglycerol kinase-produced phosphatidic acid.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15157668 2004 Diacylglycerol kinase zeta regulates phosphatidylinositol 4-phosphate 5-kinase Ialpha by a novel mechanism.
14707140 2004 Gonadotropin-releasing hormone-induced activation of diacylglycerol kinase-zeta and its association with active c-src.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14551255 2003 Diacylglycerol kinase-zeta localization in skeletal muscle is regulated by phosphorylation and interaction with syntrophins.
12890670 2003 Protein kinase C alpha phosphorylates and negatively regulates diacylglycerol kinase zeta.
12883552 2003 Enhanced T cell responses due to diacylglycerol kinase zeta deficiency.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12070163 2002 Regulation of T cell receptor-induced activation of the Ras-ERK pathway by diacylglycerol kinase zeta.
12015310 2002 Dynamics of diacylglycerol kinase zeta translocation in living T-cells. Study of the structural domain requirements for translocation and activity.
11352924 2001 Interaction of gamma 1-syntrophin with diacylglycerol kinase-zeta. Regulation of nuclear localization by PDZ interactions.
11309392 2001 Nuclear diacylglycerol kinase-theta is activated in response to alpha-thrombin.
11257115 2001 Diacylglycerol kinase zeta regulates Ras activation by a novel mechanism.
11078732 2001 Diacylglycerol kinase zeta in hypothalamus interacts with long form leptin receptor. Relation to dietary fat and body weight regulation.
9716136 1998 Protein kinase C regulates the nuclear localization of diacylglycerol kinase-zeta.
9159104 1997 Alternative splicing of the human diacylglycerol kinase zeta gene in muscle.
8626588 1996 Molecular cloning and characterization of a novel human diacylglycerol kinase zeta.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.