Property Summary

NCBI Gene PubMed Count 24
PubMed Score 18.81
PubTator Score 12.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 2.200 1.1e-04
osteosarcoma -1.761 3.0e-04
ependymoma -1.200 1.1e-04
atypical teratoid/rhabdoid tumor -1.400 1.2e-04
sonic hedgehog group medulloblastoma -1.400 5.5e-03
subependymal giant cell astrocytoma -1.920 1.8e-02
lung carcinoma 1.800 1.8e-19

Gene RIF (7)

PMID Text
24486543 these results indicate that DGKG is an anionic phospholipid binding protein that preferably interacts with a small highly charged head group that is very close to the glycerol or sphingosine backbone.
20816195 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20215397 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20200978 Observational study of gene-disease association. (HuGE Navigator)
17803461 the interaction of diacylglycerol kinase gamma with the Src homology 2 and C1 domains of beta2-chimaerin is induced synergistically by Phorbol ester and hydrogen peroxide
12732202 diacylglycerol kinase gamma regulates macrophage differentiation.

AA Sequence

MGEERWVSLTPEEFDQLQKYSEYSSKKIKDALTEFNEGGSLKQYDPHEPISYDVFKLFMRAYLEVDLPQP      1 - 70
LSTHLFLAFSQKPRHETSDHPTEGASNSEANSADTNIQNADNATKADEACAPDTESNMAEKQAPAEDQVA     71 - 140
ATPLEPPVPRSSSSESPVVYLKDVVCYLSLLETGRPQDKLEFMFRLYDSDENGLLDQAEMDCIVNQMLHI    141 - 210
AQYLEWDPTELRPILKEMLQGMDYDRDGFVSLQEWVHGGMTTIPLLVLLGMDDSGSKGDGRHAWTMKHFK    211 - 280
KPTYCNFCHIMLMGVRKQGLCCTYCKYTVHERCVSRNIPGCVKTYSKAKRSGEVMQHAWVEGNSSVKCDR    281 - 350
CHKSIKCYQSVTARHCVWCRMTFHRKCELSTLCDGGELRDHILLPTSICPITRDRPGEKSDGCVSAKGEL    351 - 420
VMQYKIIPTPGTHPLLVLVNPKSGGRQGERILRKFHYLLNPKQVFNLDNGGPTPGLNFFRDTPDFRVLAC    421 - 490
GGDGTVGWILDCIDKANFAKHPPVAVLPLGTGNDLARCLRWGGGYEGGSLTKILKDIEQSPLVMLDRWHL    491 - 560
EVIPREEVENGDQVPYSIMNNYFSIGVDASIAHRFHVMREKHPEKFNSRMKNKLWYFEFGTSETFAATCK    561 - 630
KLHDHIELECDGVGVDLSNIFLEGIAILNIPSMYGGTNLWGENKKNRAVIRESRKGVTDPKELKFCVQDL    631 - 700
SDQLLEVVGLEGAMEMGQIYTGLKSAGRRLAQCASVTIRTNKLLPMQVDGEPWMQPCCTIKITHKNQAPM    701 - 770
MMGPPQKSSFFSLRRKSRSKD                                                     771 - 791
//

Text Mined References (28)

PMID Year Title
24486543 2014 Diacylglycerol kinase ? is a novel anionic phospholipid binding protein with a selective binding preference.
22627129 2012 Biosynthesis of alkyl lysophosphatidic acid by diacylglycerol kinases.
20816195 2010 Analyses of shared genetic factors between asthma and obesity in children.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20215397 2010 Implication of genetic variants near NEGR1, SEC16B, TMEM18, ETV5/DGKG, GNPDA2, LIN7C/BDNF, MTCH2, BCDIN3D/FAIM2, SH2B1, FTO, MC4R, and KCTD15 with obesity and type 2 diabetes in 7705 Chinese.
20200978 2010 Replication of previous genome-wide association studies of bone mineral density in premenopausal American women.
19079260 2009 Genome-wide association yields new sequence variants at seven loci that associate with measures of obesity.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17803461 2008 Phorbol ester and hydrogen peroxide synergistically induce the interaction of diacylglycerol kinase gamma with the Src homology 2 and C1 domains of beta2-chimaerin.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16905533 2006 Phosphorylation and up-regulation of diacylglycerol kinase gamma via its interaction with protein kinase C gamma.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16407189 2006 Nuclear transportation of diacylglycerol kinase gamma and its possible function in the nucleus.
16288460 2006 Signaling roles of diacylglycerol kinases.
15578578 2005 Differentiation of HL-60 cells to granulocytes involves regulation of select diacylglycerol kinases (DGKs).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15212759 2004 Diacylglycerol kinases.
15194113 2004 Divergent and convergent signaling by the diacylglycerol second messenger pathway in mammals.
15150663 2004 Hepato-cerebral syndrome: genetic and pathological studies in an infant with a dGK mutation.
15102830 2004 Diacylglycerol kinase gamma serves as an upstream suppressor of Rac1 and lamellipodium formation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12941073 2003 Identification of mRNAs for the various diacylglycerol kinase isoforms in neutrophils from patients with localized aggressive periodontitis.
12732202 2003 Regulatory role of diacylglycerol kinase gamma in macrophage differentiation of leukemia cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10071200 1999 Mapping and genomic characterization of the gene encoding diacylglycerol kinase gamma (DAGK3): assessment of its role in dominant optic atrophy (OPA1).
9003401 1997 EF-hand motifs of alpha, beta and gamma isoforms of diacylglycerol kinase bind calcium with different affinities and conformational changes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8034597 1994 Molecular cloning of a diacylglycerol kinase isozyme predominantly expressed in human retina with a truncated and inactive enzyme expression in most other human cells.