Property Summary

NCBI Gene PubMed Count 42
PubMed Score 76.64
PubTator Score 62.10

Knowledge Summary

Patent (3,433)

Expression

  Differential Expression (10)

Disease log2 FC p
Rheumatoid Arthritis -1.900 2.6e-03
malignant mesothelioma -3.400 1.0e-08
esophageal adenocarcinoma -2.300 2.1e-02
psoriasis -1.700 3.2e-03
osteosarcoma -2.586 6.6e-08
medulloblastoma, large-cell -1.100 9.5e-04
primary pancreatic ductal adenocarcinoma 1.227 3.0e-02
non-small cell lung cancer 1.217 3.3e-10
active Crohn's disease -1.235 2.6e-02
pancreatic cancer 1.200 2.8e-02

Protein-protein Interaction (6)

Gene RIF (21)

PMID Text
26964756 Decreased DNA methylation at this enhancer enables recruitment of the profibrotic transcription factor early growth response 1 (EGR1) and facilitates radiation-induced DGKA transcription in cells from patients later developing fibrosis.
26420856 An abandoned compound that also inhibits serotonin receptors may have more translational potential as a DGKa inhibitor, but more potent and specific DGKa inhibitors are sorely needed
25921290 Redundant and specialized roles for diacylglycerol kinases alpha and zeta in the control of T cell functions.
25248744 DGKalpha generates phosphatidic acid to drive its own recruitment to tubular recycling endosomes via its interaction with MICAL-L1
24887021 These data indicates the existence of a SDF-1alpha induced DGKalpha - atypical PKC - beta1 integrin signaling pathway, which is essential for matrix invasion of carcinoma cells.
24158111 High diacylglycerol kinase alpha expression is associated with glioblastoma.
22573804 DGK-alpha was more highly expressed in CD8-tumor-infiltrating T cellscompared with that in CD8non-tumor kidney-infiltrating lymphocytes.
22425622 DGKalpha is involved in hepatocellular carcinoma progression by activation of the MAPK pathway.
22271650 Antigen-specific CD8-positive T cells from DGKalpha-deficient transgenic mice show enhanced expansion and increased cytokine production after lymphocytic choriomeningitis virus infection, yet DGK-deficient memory CD8+ T cells exhibit impaired expansion.
22048771 SAP-mediated inhibition of DGKalpha sustains diacylglycerol signaling, thereby regulating T cell activation
21493725 findings further suggest that DGL-alpha and -beta may regulate neurite outgrowth by engaging temporally and spatially distinct molecular pathways
21252909 Diacylglycerol kinase alpha is a key regulator of the polarised secretion of exosomes.
19751727 These results strongly suggest that DGKalpha positively regulates TNF-alpha-dependent NF-kappaB activation via the PKCzeta-mediated Ser311 phosphorylation of p65/RelA.
18424699 Lck-dependent tyrosine phosphorylation of diacylglycerol kinase alpha regulates its membrane association in T cells.(
18004883 2,3-dioleoylglycerol binds to a site on the alpha and zeta isoforms of diacylglycerol kinase that is exposed as a consequence of the substrate binding to the active site.
17911109 diacylglycerol kinase alpha-conserved domains have a role in membrane targeting in intact T cells
17276726 These results strongly suggest that DGKalpha is a novel positive regulator of NF-kappaB, which suppresses TNF-alpha-induced melanoma cell apoptosis.
15928040 ALK-mediated alphaDGK activation is dependent on p60src tyrosine kinase, with which alphaDGK forms a complex; alphaDGK activation is involved in the control of ALK-mediated mitogenic properties.
15870081 DGKalpha is crucial for the control of cell activation and also for the regulation of the secretion of lethal exosomes, which in turn controls cell death.
15117825 PPARgamma agonists upregulate DGKalpha production.This suppresses the diacylglycerol/protein-kinase-C signaling pathway.
14734770 Defects in both polymorphonuclear neutrophil (PMN) transendothelial migration and PMN diacylglycerol kinase alpha signaling are implicated as disordered functions in subjects with localized aggressive periodontitis.

AA Sequence

MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHL      1 - 70
SLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIIL     71 - 140
QMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRP    141 - 210
KRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESG    211 - 280
RCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKT    281 - 350
SQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRL    351 - 420
FKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLE    421 - 490
MSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFE    491 - 560
FATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALG    561 - 630
ATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGE    631 - 700
PWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS                                       701 - 735
//

Text Mined References (45)

PMID Year Title
26964756 2016 Epigenetic regulation of diacylglycerol kinase alpha promotes radiation-induced fibrosis.
26420856 2015 Molecular Pathways: Targeting Diacylglycerol Kinase Alpha in Cancer.
25921290 2015 Redundant and specialized roles for diacylglycerol kinases ? and ? in the control of T cell functions.
25248744 2014 Diacylglycerol kinase ? regulates tubular recycling endosome biogenesis and major histocompatibility complex class I recycling.
24887021 2014 The diacylglycerol kinase ?/atypical PKC/?1 integrin pathway in SDF-1? mammary carcinoma invasiveness.
24158111 2013 A miR-297/hypoxia/DGK-? axis regulating glioblastoma survival.
22951725 2013 Association analyses identify three susceptibility Loci for vitiligo in the Chinese Han population.
22627129 2012 Biosynthesis of alkyl lysophosphatidic acid by diacylglycerol kinases.
22573804 2012 High DGK-? and disabled MAPK pathways cause dysfunction of human tumor-infiltrating CD8+ T cells that is reversible by pharmacologic intervention.
22425622 2012 Diacylglycerol kinase alpha enhances hepatocellular carcinoma progression by activation of Ras-Raf-MEK-ERK pathway.
22271650 2012 Differential regulation of primary and memory CD8 T cell immune responses by diacylglycerol kinases.
22048771 2011 SAP-mediated inhibition of diacylglycerol kinase ? regulates TCR-induced diacylglycerol signaling.
21493725 2011 Diacylglycerol lipase-alpha and -beta control neurite outgrowth in neuro-2a cells through distinct molecular mechanisms.
21269460 2011 Initial characterization of the human central proteome.
21252909 2011 Diacylglycerol kinase ? regulates the formation and polarisation of mature multivesicular bodies involved in the secretion of Fas ligand-containing exosomes in T lymphocytes.
20160093 2010 Diacylglycerol kinase alpha mediates HGF-induced Rac activation and membrane ruffling by regulating atypical PKC and RhoGDI.
19946888 2010 Defining the membrane proteome of NK cells.
19751727 2009 Diacylglycerol kinase alpha enhances protein kinase Czeta-dependent phosphorylation at Ser311 of p65/RelA subunit of nuclear factor-kappaB.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18424699 2008 Lck-dependent tyrosine phosphorylation of diacylglycerol kinase alpha regulates its membrane association in T cells.
18004883 2007 Substrate chirality and specificity of diacylglycerol kinases and the multisubstrate lipid kinase.
17911109 2007 Role of the diacylglycerol kinase alpha-conserved domains in membrane targeting in intact T cells.
17898083 2007 Diacylglycerol kinase-alpha mediates hepatocyte growth factor-induced epithelial cell scatter by regulating Rac activation and membrane ruffling.
17700527 2008 Diacylglycerol kinase-alpha phosphorylation by Src on Y335 is required for activation, membrane recruitment and Hgf-induced cell motility.
17276726 2007 Diacylglycerol kinase alpha suppresses tumor necrosis factor-alpha-induced apoptosis of human melanoma cells through NF-kappaB activation.
16541075 2006 The finished DNA sequence of human chromosome 12.
16341674 2005 Transcriptome analysis of human gastric cancer.
15928040 2005 Activation of alpha-diacylglycerol kinase is critical for the mitogenic properties of anaplastic lymphoma kinase.
15870081 2005 Diacylglycerol kinase alpha regulates the secretion of lethal exosomes bearing Fas ligand during activation-induced cell death of T lymphocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15122338 2004 Activation of diacylglycerol kinase alpha is required for VEGF-induced angiogenic signaling in vitro.
15117825 2004 PPARgamma agonists ameliorate endothelial cell activation via inhibition of diacylglycerol-protein kinase C signaling pathway: role of diacylglycerol kinase.
14734770 2004 A molecular defect in intracellular lipid signaling in human neutrophils in localized aggressive periodontal tissue damage.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14559993 2003 Regulation of alternative splicing by SRrp86 and its interacting proteins.
12626538 2003 T cell activation in vivo targets diacylglycerol kinase alpha to the membrane: a novel mechanism for Ras attenuation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11285286 2001 Role of diacylglycerol kinase alpha in the attenuation of receptor signaling.
10970854 2000 Src-mediated activation of alpha-diacylglycerol kinase is required for hepatocyte growth factor-induced cell motility.
10358029 1999 Interleukin-2 causes an increase in saturated/monounsaturated phosphatidic acid derived from 1,2-diacylglycerol and 1-O-alkyl-2-acylglycerol.
10206945 1999 Mammalian diacylglycerol kinases, a family of lipid kinases with signaling functions.
8626603 1996 Phosphatidic acid generation through interleukin 2 (IL-2)-induced alpha-diacylglycerol kinase activation is an essential step in IL-2-mediated lymphocyte proliferation.
8180475 1994 Assignment of the gene for diacylglycerol kinase (DAGK) to human chromosome 12.
7959783 1994 Assignment of the human diacylglycerol kinase gene (DAGK) to 12q13.3 using fluorescence in situ hybridization analysis.
2175712 1990 Purification, cDNA-cloning and expression of human diacylglycerol kinase.