Property Summary

NCBI Gene PubMed Count 65
PubMed Score 254.13
PubTator Score 152.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -2.000 3.7e-04
osteosarcoma -1.348 1.3e-04
intraductal papillary-mucinous adenoma (... 1.400 1.8e-04
intraductal papillary-mucinous carcinoma... 1.200 7.4e-04
intraductal papillary-mucinous neoplasm ... 1.600 2.2e-03
cystic fibrosis -1.200 4.4e-05
ovarian cancer 1.200 3.5e-04

Gene RIF (47)

PMID Text
26804549 Results demonstrated that DGCR8 is significantly upregulated in invasive ductal breast carcinoma, suggesting that increased expression of DGCR8 may play a fundamental role during the process of breast carcinogenesis.
26687677 Results show that DGCR8 forms an alternative complex with the RRP6-containing form of the exosome, acts as an adaptor to recruit the exosome to target structured RNAs, and the DGCR8/hRRP6 complex controls the stability of human telomerase RNA.
26683315 DGCR8 and Drosha assemble into a heterotrimeric complex on RNA, comprising two DGCR8 molecules and one Drosha molecule.
26126715 These results reveal a new pathway in the DNA damage response wherein ABL-dependent tyrosine phosphorylation of DGCR8 stimulates the processing of selective primary miRNAs.
26027739 Together with a 23-amino acid peptide from DGCR8, DROSHA constitutes a minimal functional core. DROSHA serves as a "ruler" by measuring 11 bp from the basal ssRNA-dsRNA junction. DGCR8 interacts with the stem and apical elements through its dsRNA-binding domains and RNA-binding heme domain, respectively, allowing efficient and accurate processing.
25823356 DGCR8 functions as an oncogene in ovarian cancer, which is in part mediated by miR-27b.
25670083 Recurrent mutations included a hotspot mutation (Q177R) in the homeo-domain of SIX1 and SIX2 in tumors with high proliferative potential (18.1% of blastemal cases); mutations in the DROSHA/DGCR8 microprocessor genes
25670082 in tumors with DGCR8 E518K and DROSHA exon 29 (miRNAPG-HS) mutations ... greater prevalence of tumors with blastemal predominant histology in patients with miRNAPG-HS and/or SIX1/2 Q177R mutations
25439752 We aimed to evaluate the expression of the major components of microRNA biogenesis machinery including Drosha, Dicer and DiGeorge syndrome critical region gene 8 (DGCR8) in multiple sclerosis patients
25427980 These data show that hepatitis B virus proteins repress DGCR8 promoter activity by upregulating the expression of transcription factor YY1.
25084529 Data show decreased DGCR8 expression and miRNA dysregulation in individuals with 22q11.2 deletion syndrome
24910438 Study reveals a unique protein-RNA interaction central to pri-miRNA recognition. We propose a unifying model in which two DGCR8 dimers clamp a pri-miRNA hairpin using their Rheds.
24589731 The Microprocessor complex of Drosha and DGCR8 proteins, which is responsible for the processing of the primary transcripts during the generation of microRNAs, destabilizes the mRNA of Aurora kinase B.
24449888 These data reveal a role for DeltaNp63 in the transcriptional regulation of DGCR8 to reprogram adult somatic cells into multipotent stem cells.
24239349 multisite phosphorylation regulates DGCR8 protein stability, thereby raising microprocessor complex levels, changing the mature miRNA profile of the cell, and increasing cell proliferation and migration
23893406 specific RNA processing is likely facilitated by preformed DGCR8-Drosha heterodimers that can discriminate between authentic substrates and other hairpins
23863141 RNase III enzyme Drosha and the double-stranded RNA-binding protein DGCR8 binds and regulates a large variety of cellular RNAs
23775303 This study demonstrated for the first time that the DGCR8 mRNA expression level was up-regulated in colorectal carcinomas, suggesting its important role in pathobiology of colorectal carcinogenesis.
23773483 A subset of senescence-associated miRNAs with the potential to target p21CIP1 is downregulated during DGCR8-mediated senescence.
23663110 It is a miRNA processing enzyme and altered in non-alcoholic fatty liver disease.
23629745 Single nucleotide polymorphisms in the DGCR8 3'-UTR that binds to miR-106b/miR-579 is associated with breast cancer.
22796965 DGCR8-mediated cleavage of snoRNAs was independent of Drosha, suggesting the involvement of DGCR8 in cellular complexes with other endonucleases. Binding of DGCR8 to cassette exons is a new mechanism for regulation of alternatively spliced isoforms.
22434730 DGCR8 is cleaved by caspases between Asp396 and Ser397 in HeLa cells.
22393237 DGCR8 and Drosha are targeted post-transcriptionally to chromosome 19 microRNA cluster pri-miRNAs as a preformed complex but dissociate separately.
22308374 This study demonstrates binding specificity of DGCR8 for ferric heme, provides direct biochemical evidence for ferric heme serving as an activator for miRNA maturation.
22222205 HDAC1 is an integral component of the Drosha/DGCR8 complex and enhances miRNA processing by increasing the affinity of DGCR8 to primary miRNA transcripts via deacetylation of critical lysine residues in the RNA-binding domains of DGCR8.
22025453 DGCR8, AGO1, AGO2, PACT, and TARBP1 expression levels were significantly higher in the epithelial skin cancer groups than the healthy controls (P > 0.05).
21454614 analysis of the function of the DGCR8-heme interaction in microRNA maturation
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20732906 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20721975 Observational study of gene-disease association. (HuGE Navigator)
20585341 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20506313 The dimerization domain of DGCR8 is embedded in an independently folded heme-binding domain and directly contributes to association with heme. Heme-binding-deficient DGCR8 mutants have reduced pri-miRNA processing activity in vitro.
19902333 SRY is a hybrid of DGCR8 and SOX3, and is regulated by the transcription factor CP2.
19851984 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19759829 a Microprocessor, containing the RNA binding protein Dgcr8 and RNase III enzyme Drosha, is responsible for processing primary microRNAs to precursor microRNAs
19721432 The mRNA for microprocessor component DGCR8 was found to be significantly upregulated in the dorsolateral prefrontal cortex and superior temporal gyrus in tissues from schizophrenic patients.
19138993 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19135890 The Drosha-DGCR8 complex cleaves the hairpin in the DGCR8 mRNA and thus destabilizes the mRNA; DGCR8 stabilizes Drosha protein via protein interaction; this crossregulation between Drosha and DGCR8 may contribute to the control of miRNA biogenesis.
19047128 Observational study of gene-disease association. (HuGE Navigator)
17765891 DGCR8 locates at the nucleolus and small foci adjacent to splicing speckles in the nucleoplasm.
17704815 DGCR8 core recognizes pri-miRNA in two possible orientations. We propose a model for DGCR8's recognition of pri-miRNA
17159994 Study show that the RNA-binding protein DiGeorge critical region-8 (DGCR8), which is essential for the first step of miRNA processing, is a heme-binding protein; the association with heme promotes dimerization of DGCR8.
16751099 Thus, DGCR8 may function as the molecular anchor that measures the distance from the dsRNA-ssRNA junction
15589161 DGCR8 is required for the maturation of miRNA primary transcripts.
15574589 DGCR8 may be an essential component of the primary miRNA processing complex, along with Drosha.
12705904 Molecular cloning and expression analysis of DGCR8

AA Sequence

METDESPSPLPCGPAGEAVMESRARPFQALPREQSPPPPLQTSSGAEVMDVGSGGDGQSELPAEDPFNFY      1 - 70
GASLLSKGSFSKGRLLIDPNCSGHSPRTARHAPAVRKFSPDLKLLKDVKISVSFTESCRSKDRKVLYTGA     71 - 140
ERDVRAECGLLLSPVSGDVHACPFGGSVGDGVGIGGESADKKDEENELDQEKRVEYAVLDELEDFTDNLE    141 - 210
LDEEGAGGFTAKAIVQRDRVDEEALNFPYEDDFDNDVDALLEEGLCAPKKRRTEEKYGGDSDHPSDGETS    211 - 280
VQPMMTKIKTVLKSRGRPPTEPLPDGWIMTFHNSGVPVYLHRESRVVTWSRPYFLGTGSIRKHDPPLSSI    281 - 350
PCLHYKKMKDNEEREQSSDLTPSGDVSPVKPLSRSAELEFPLDEPDSMGADPGPPDEKDPLGAEAAPGAL    351 - 420
GQVKAKVEVCKDESVDLEEFRSYLEKRFDFEQVTVKKFRTWAERRQFNREMKRKQAESERPILPANQKLI    421 - 490
TLSVQDAPTKKEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVTIDGVTYGSGTASS    491 - 560
KKLAKNKAARATLEILIPDFVKQTSEEKPKDSEELEYFNHISIEDSRVYELTSKAGLLSPYQILHECLKR    561 - 630
NHGMGDTSIKFEVVPGKNQKSEYVMACGKHTVRGWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGR    631 - 700
ESSKMVKQETSDKSVIELQQYAKKNKPNLHILSKLQEEMKRLAEEREETRKKPKMSIVASAQPGGEPLCT    701 - 770
VDV                                                                       771 - 773
//

Text Mined References (84)

PMID Year Title
26804549 2016 Upregulation of the double-stranded RNA binding protein DGCR8 in invasive ductal breast carcinoma.
26748718 2016 Structure of Human DROSHA.
26687677 2015 DGCR8 Acts as an Adaptor for the Exosome Complex to Degrade Double-Stranded Structured RNAs.
26683315 2016 A heterotrimer model of the complete Microprocessor complex revealed by single-molecule subunit counting.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26321680 2015 HNRNPA2B1 Is a Mediator of m(6)A-Dependent Nuclear RNA Processing Events.
26126715 2015 The kinase ABL phosphorylates the microprocessor subunit DGCR8 to stimulate primary microRNA processing in response to DNA damage.
26027739 2015 Functional Anatomy of the Human Microprocessor.
25823356 2015 Silencing the double-stranded RNA binding protein DGCR8 inhibits ovarian cancer cell proliferation, migration, and invasion.
25799998 2015 N6-methyladenosine marks primary microRNAs for processing.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25670083 2015 Mutations in the SIX1/2 pathway and the DROSHA/DGCR8 miRNA microprocessor complex underlie high-risk blastemal type Wilms tumors.
25670082 2015 Recurrent DGCR8, DROSHA, and SIX homeodomain mutations in favorable histology Wilms tumors.
25439752 2015 Overexpression of microRNA biogenesis machinery: Drosha, DGCR8 and Dicer in multiple sclerosis patients.
25427980 2015 Regulation of the microRNA processor DGCR8 by hepatitis B virus proteins via the transcription factor YY1.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25084529 2014 Decreased DGCR8 expression and miRNA dysregulation in individuals with 22q11.2 deletion syndrome.
24910438 2014 The DGCR8 RNA-binding heme domain recognizes primary microRNAs by clamping the hairpin.
24589731 2014 Cell cycle-dependent regulation of Aurora kinase B mRNA by the Microprocessor complex.
24581491 2014 Hippo signaling regulates microprocessor and links cell-density-dependent miRNA biogenesis to cancer.
24449907 2014 Processing of microRNA primary transcripts requires heme in mammalian cells.
24449888 2014 Induced multipotency in adult keratinocytes through down-regulation of ?Np63 or DGCR8.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24239349 2013 Phosphorylation of DGCR8 increases its intracellular stability and induces a progrowth miRNA profile.
23893406 2013 The core microprocessor component DiGeorge syndrome critical region 8 (DGCR8) is a nonspecific RNA-binding protein.
23863141 2013 Cellular functions of the microprocessor.
23775303 2014 An essential microRNA maturing microprocessor complex component DGCR8 is up-regulated in colorectal carcinomas.
23773483 2013 DGCR8-mediated disruption of miRNA biogenesis induces cellular senescence in primary fibroblasts.
23663110 2013 Expression of genes for microRNA-processing enzymes is altered in advanced non-alcoholic fatty liver disease.
23629745 2013 Evaluation of genetic variants in microRNA biosynthesis genes and risk of breast cancer in Chinese women.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22796965 2012 DGCR8 HITS-CLIP reveals novel functions for the Microprocessor.
22434730 2012 Caspases cleave and inhibit the microRNA processing protein DiGeorge Critical Region 8.
22393237 2012 Microprocessor dynamics and interactions at endogenous imprinted C19MC microRNA genes.
22308374 2012 Ferric, not ferrous, heme activates RNA-binding protein DGCR8 for primary microRNA processing.
22222205 2012 Histone deacetylase 1 enhances microRNA processing via deacetylation of DGCR8.
22118463 2011 Lin28A and Lin28B inhibit let-7 microRNA biogenesis by distinct mechanisms.
22025453 2012 Expression levels of the microRNA maturing microprocessor complex component DGCR8 and the RNA-induced silencing complex (RISC) components argonaute-1, argonaute-2, PACT, TARBP1, and TARBP2 in epithelial skin cancer.
21454614 2011 DiGeorge critical region 8 (DGCR8) is a double-cysteine-ligated heme protein.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20732906 2010 Genetic variations in microRNA-related genes are associated with survival and recurrence in patients with renal cell carcinoma.
20721975 2010 Association of a common AGO1 variant with lung cancer risk: a two-stage case-control study.
20585341 2011 Role of primary miRNA polymorphic variants in metastatic colon cancer patients treated with 5-fluorouracil and irinotecan.
20506313 2010 Structure of the dimerization domain of DiGeorge critical region 8.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19902333 2010 The male-determining gene SRY is a hybrid of DGCR8 and SOX3, and is regulated by the transcription factor CP2.
19851984 2010 Genetic variation in MicroRNA genes and risk of oral premalignant lesions.
19759829 2009 Genomic analysis suggests that mRNA destabilization by the microprocessor is specialized for the auto-regulation of Dgcr8.
19721432 2010 Schizophrenia is associated with an increase in cortical microRNA biogenesis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19138993 2008 Genetic variations in microRNA-related genes are novel susceptibility loci for esophageal cancer risk.
19135890 2009 Posttranscriptional crossregulation between Drosha and DGCR8.
19047128 2008 Single nucleotide polymorphisms of microRNA machinery genes modify the risk of renal cell carcinoma.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17765891 2007 Nucleolar localization of DGCR8 and identification of eleven DGCR8-associated proteins.
17704815 2007 Crystal structure of human DGCR8 core.
17159994 2007 Heme is involved in microRNA processing.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16963499 2006 Characterization of DGCR8/Pasha, the essential cofactor for Drosha in primary miRNA processing.
16906129 2006 Formation of GW bodies is a consequence of microRNA genesis.
16751099 2006 Molecular basis for the recognition of primary microRNAs by the Drosha-DGCR8 complex.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15589161 2004 The human DiGeorge syndrome critical region gene 8 and Its D. melanogaster homolog are required for miRNA biogenesis.
15574589 2004 The Drosha-DGCR8 complex in primary microRNA processing.
15531877 2004 The Microprocessor complex mediates the genesis of microRNAs.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12705904 2003 Molecular cloning and expression analysis of a novel gene DGCR8 located in the DiGeorge syndrome chromosomal region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10591208 1999 The DNA sequence of human chromosome 22.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.