Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.81
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MERYAAALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEI      1 - 70
QHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVVQAAQQRELEAVEHRIREEQRAMDQK     71 - 140
IILELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCRAGNAALGLGGPWQSPAAQ    141 - 210
CDQKGSPVPP                                                                211 - 220
//

Text Mined References (12)

PMID Year Title