Property Summary

NCBI Gene PubMed Count 33
PubMed Score 98.97
PubTator Score 44.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
primitive neuroectodermal tumor -1.300 4.6e-03
Atopic dermatitis -2.300 5.7e-05
pancreatic ductal adenocarcinoma liver m... -1.774 2.6e-04
intraductal papillary-mucinous neoplasm ... 1.300 9.7e-03
breast carcinoma -2.000 1.0e-02
fibroadenoma -2.700 4.3e-02
interstitial cystitis -1.800 2.0e-05
pilocytic astrocytoma -1.100 5.9e-05
ductal carcinoma in situ -3.800 6.7e-04
invasive ductal carcinoma -4.400 8.2e-04
pituitary cancer 1.500 3.2e-04
psoriasis -1.200 1.9e-42

Protein-protein Interaction (1)

Gene RIF (18)

PMID Text
25244504 uPA/uPAR stimulates triglyceride synthesis in Huh7 hepatoma cells via p38-dependent upregulation of DGAT2
24820123 DGAT2 is regulated by gp78-associated endoplasmic-reticulum-associated degradation at the post-translational level.
23489367 Hepatic triacylglycerol synthesis and secretion: DGAT2 as the link between glycaemia and triglyceridaemia.
22748069 describe distinct but synergistic roles of the two DGATs in an integrated pathway of TAG synthesis and secretion, with DGAT2 acting upstream of DGAT1
22315393 Niacin treatment may reduce liver fat content in Chinese patients with dyslipidemia and the mechanism may involve inhibition of DGAT2.
20679960 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19049983 DGAT2, an ER-resident transmembrane domain-containing enzyme, is also found in mitochondria-associated membranes, where its N terminus may promote its association with mitochondria.
18980578 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18757836 Review summarizes current knowledge of DGAT1 and DGAT2 enzymes, focusing on new advances since the cloning of their genes, including possible roles in human health and diseases.
17940217 Overexpression of human DGAT2 in glycolytic muscle of mice promotes insulin resistance in this tissue and may contribute to the development of diabetes.
17504763 diacylglycerol acyltransferase 2 expression is regulated by CAAT/enhancer-binding protein beta (C/EBPbeta) and C/EBPalpha during adipogenesis
17477860 Observational study of gene-disease association. (HuGE Navigator)
17477860 our results do not support the hypothesis of an important role of common genetic variation in DGAT2 for the development of obesity
15258194 Niacin selectively inhibited DGAT2 but not DGAT1 activity, but had no effect on the expression of DGAT1 and DGAT2 mRNA
14521909 DGAT2 expression is decreased in psoriatic skin.

AA Sequence

MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLNRSKVEKQLQV      1 - 70
ISVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKGGRRSQWVRNWAVWRYFRDYF     71 - 140
PIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMS    141 - 210
GGICPVSRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFG    211 - 280
ENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHP    281 - 350
TQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN                                    351 - 388
//

Text Mined References (36)

PMID Year Title
26349027 2015 Discovery and Optimization of Imidazopyridine-Based Inhibitors of Diacylglycerol Acyltransferase 2 (DGAT2).
25813485 2015 Stress of endoplasmic reticulum modulates differentiation and lipogenesis of human adipocytes.
25792450 2015 Roles of Acyl-CoA:Diacylglycerol Acyltransferases 1 and 2 in Triacylglycerol Synthesis and Secretion in Primary Hepatocytes.
25244504 2014 Urokinase-type plasminogen activator (uPA) stimulates triglyceride synthesis in Huh7 hepatoma cells via p38-dependent upregulation of DGAT2.
24820123 2014 Regulation of diacylglycerol acyltransferase 2 protein stability by gp78-associated endoplasmic-reticulum-associated degradation.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23489367 2013 Hepatic triacylglycerol synthesis and secretion: DGAT2 as the link between glycaemia and triglyceridaemia.
22748069 2012 Diacylglycerol acyltransferase 2 acts upstream of diacylglycerol acyltransferase 1 and utilizes nascent diglycerides and de novo synthesized fatty acids in HepG2 cells.
22315393 2012 Liver fat reduction with niacin is influenced by DGAT-2 polymorphisms in hypertriglyceridemic patients.
21933415 2011 Evolutionary view of acyl-CoA diacylglycerol acyltransferase (DGAT), a key enzyme in neutral lipid biosynthesis.
20739640 2010 Involvement and mechanism of DGAT2 upregulation in the pathogenesis of alcoholic fatty liver disease.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19049983 2009 The endoplasmic reticulum enzyme DGAT2 is found in mitochondria-associated membranes and has a mitochondrial targeting signal that promotes its association with mitochondria.
18980578 2009 The DGAT2 gene is a candidate for the dissociation between fatty liver and insulin resistance in humans.
18757836 2008 Thematic review series: glycerolipids. DGAT enzymes and triacylglycerol biosynthesis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17940217 2007 Increased lipid accumulation and insulin resistance in transgenic mice expressing DGAT2 in glycolytic (type II) muscle.
17504763 2007 Sequential regulation of diacylglycerol acyltransferase 2 expression by CAAT/enhancer-binding protein beta (C/EBPbeta) and C/EBPalpha during adipogenesis.
17477860 2007 Mutation screen and association studies in the diacylglycerol O-acyltransferase homolog 2 gene (DGAT2), a positional candidate gene for early onset obesity on chromosome 11q13.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16870193 2007 Sustained elevations in NEFA induce cyclooxygenase-2 activity and potentiate THP-1 macrophage foam cell formation.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16214399 2005 Acyl coenzyme A dependent retinol esterification by acyl coenzyme A: diacylglycerol acyltransferase 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15258194 2004 Niacin noncompetitively inhibits DGAT2 but not DGAT1 activity in HepG2 cells.
15221005 2004 Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas.
14970677 2003 Genomic organization of the DGAT2/MOGAT gene family in cattle (Bos taurus) and other mammals.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14521909 2003 A novel diacylglycerol acyltransferase (DGAT2) is decreased in human psoriatic skin and increased in diabetic mice.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11481335 2001 Cloning of DGAT2, a second mammalian diacylglycerol acyltransferase, and related family members.
8944226 1996 Biosynthesis of triacylglycerols.