Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.83
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus 1.100 1.5e-02
psoriasis -1.500 1.4e-04
osteosarcoma -1.314 3.0e-05
medulloblastoma -1.400 1.3e-09
atypical teratoid/rhabdoid tumor -1.500 4.0e-09
glioblastoma -1.200 1.4e-05
pancreatic ductal adenocarcinoma liver m... -1.544 1.5e-03
pediatric high grade glioma -1.100 9.6e-07
posterior fossa group A ependymoma -1.100 1.8e-09
lung adenocarcinoma 1.500 2.3e-09

Synonym

Accession Q6ICB0 DeSI-1
Symbols DESI2
DeSI-1
PPPDE2
FAM152B
D15Wsu75e
DJ347H13.4

Gene

PDB

3EBQ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEPPNLYPVKLYVYDLSKGLARRLSPIMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDS      1 - 70
VVDVGSTEVTEEIFLEYLSSLGESLFRGEAYNLFEHNCNTFSNEVAQFLTGRKIPSYITDLPSEVLSTPF     71 - 140
GQALRPLLDSIQIQPPGGSSVGRPNGQS                                              141 - 168
//

Text Mined References (12)

PMID Year Title
22370726 2012 DeSUMOylating isopeptidase: a second class of SUMO protease.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.