Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.79
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 2.0e-06
cutaneous lupus erythematosus 1.100 1.5e-02
glioblastoma -1.200 1.4e-05
group 3 medulloblastoma -1.100 7.0e-05
lung adenocarcinoma 1.500 2.3e-09
osteosarcoma -1.314 3.0e-05
pancreatic ductal adenocarcinoma liver m... -1.544 1.5e-03
pediatric high grade glioma -1.100 9.6e-07
posterior fossa group A ependymoma -1.100 1.8e-09
psoriasis 1.300 4.4e-03

Gene RIF (2)

AA Sequence

MEPPNLYPVKLYVYDLSKGLARRLSPIMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDS      1 - 70
VVDVGSTEVTEEIFLEYLSSLGESLFRGEAYNLFEHNCNTFSNEVAQFLTGRKIPSYITDLPSEVLSTPF     71 - 140
GQALRPLLDSIQIQPPGGSSVGRPNGQS                                              141 - 168
//

Text Mined References (12)

PMID Year Title