Property Summary

NCBI Gene PubMed Count 18
PubMed Score 25.14
PubTator Score 2.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
interstitial cystitis 1.700 6.0e-03
intraductal papillary-mucinous adenoma (... -1.400 1.0e-02
intraductal papillary-mucinous carcinoma... -1.500 7.4e-03
intraductal papillary-mucinous neoplasm ... -1.700 2.0e-02
lung adenocarcinoma 1.300 1.6e-15
osteosarcoma -1.957 2.0e-07
ovarian cancer 1.200 7.7e-10
periodontitis 1.200 1.9e-20
ulcerative colitis 1.700 2.7e-04

Gene RIF (2)

AA Sequence

MAWQGLAAEFLQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLVTNFLFFGPLGFS      1 - 70
FFFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGVLMTLLGLLGSLFFLGQALMAMLVYVWSRRSPRVR     71 - 140
VNFFGLLTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGHIYYFLEDVFPNQPGGKRLLQTPGFLKLLLD    141 - 210
APAEDPNYLPLPEEQPGPHLPPPQQ                                                 211 - 235
//

Text Mined References (19)

PMID Year Title