Property Summary

NCBI Gene PubMed Count 38
PubMed Score 42.29
PubTator Score 31.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
interstitial lung disease -1.100 4.4e-02
malignant mesothelioma -5.400 8.3e-10
osteosarcoma 2.090 9.9e-04
cystic fibrosis -2.759 6.5e-06
atypical teratoid / rhabdoid tumor -1.100 9.6e-05
medulloblastoma -1.200 4.1e-04
Duchenne muscular dystrophy -1.047 8.7e-06
adrenocortical carcinoma -1.699 1.3e-03
intraductal papillary-mucinous adenoma (... 1.600 1.5e-02
interstitial cystitis -1.400 3.2e-04
aldosterone-producing adenoma -1.480 1.8e-02
lung adenocarcinoma 2.138 1.2e-06
lung carcinoma 1.500 3.1e-08
non-small cell lung carcinoma 1.300 1.6e-17
Breast cancer -1.100 1.7e-03
ovarian cancer 1.800 3.7e-04
pituitary cancer -2.300 3.4e-05

Gene RIF (27)

PMID Text
26717892 Cul1 promoted mTORC1 activity and cap-dependent translation by enhancing the ubiquitination and degradation of DEPTOR.
26608079 Propose regulation of placental SNAT2/LAT1 ubiquitination by mTORC1 and Nedd4-2.
25936805 Data indicate that phosphatidic acid (PA) specifically disrupts DEPTOR-mTORC1 interaction.
25843797 conclude that DEPTOR-related mTOR suppression is involved in metformin's anti-cancer action in liver, and could be a novel target for anti-cancer therapy
25810016 Deptor enhances triple-negative breast cancer metastasis and chemoresistance through coupling to survivin expression
25605718 Receptor CXCR4 signaling promotes lysosomal and ESCRT-dependent degradation of DEPTOR, an antagonist of mTORC2, that regulates Akt activation and signaling.
25544749 Data suggest that DEPTOR has a tumor suppressive activity against pancreatic cancer cells, and its loss of expression may contribute to pancreatic tumorigenesis.
25333702 our data provide evidence for the requirement of TGFbeta-activated mTORC1 only by deptor downregulation, which dominates upon the bystander mTORC2 activity for enhanced expression of collagen I (alpha2).
25258312 DEPTOR plays a key role in maintaining stem cell pluripotency by limiting mTOR activity in undifferentiated embryonic stem cells
25119265 In Alzheimer's disease patients the mTOR pathway can be overactive, leading to a dysfunction of autophagy and a lack of amyloid beta clearance so the excess of amyloid beta will cause a further decrease in DEPTOR and an increase in mTOR expression.
24969890 Downregulation of DEPTOR (p=0.331) in CRC.
23881914 these findings define DEPTOR as a critical upstream regulator of endothelial cell activation responses.
23613505 Downregulation of DEPTOR inhibited proliferation and increased chemosensitivity to melphalan in human multiple myeloma RPMI-8226 cells via inhibiting the PI3K/AKT pathway.
23563706 Deptor is induced by the Baf60c-Six4 transcriptional complex and mediates activation of Akt and glycolytic metabolism by Baf60c in a cell-autonomous manner
23541542 There is a significant downregulation of mTOR, DEPTOR, and Raptor in preterm labouring myometria when compared to non-pregnant tissues taken from the same area.
23503641 the downregulation of DEPTOR induces apoptosis, increases chemosensitivity to doxorubicin, and suppresses autophagy and the activation of the PI3K/Akt signaling pathway in RPMI8226 human multiple myeloma cells.
22454292 this review discusses beta-TrCP's new downstream substrate, DEPTOR, as well as summarize the novel functional aspects of beta-TrCP in controlling cell growth and regulating autophagy, in part through governing the stability of DEPTOR.[Review]
22282237 Raf-1/JNK /p53/p21 pathway may be involved in apoptosis, and NFkappaB1 may play a possible role in inhibiting apoptosis.
22160218 GNMT regulates hepatocellular carcinoma growth in part through interacting with DEPDC6/DEPTOR and modulating mTOR/raptor signaling pathway
22017877 mTOR generates an auto-amplification loop by triggering the betaTrCP- and CK1alpha-dependent degradation of DEPTOR.
22017876 DEPTOR, an mTOR inhibitor, is a physiological substrate of SCF(betaTrCP) E3 ubiquitin ligase and regulates survival and autophagy
22017875 misregulation of the DEPTOR destruction pathway might contribute to aberrant activation of mTOR in disease.
21992080 These novel findings are indicative of a higher order of complexity of DEPTOR signalling in the human placenta that is affected by maternal stress.
21643629 DEPTOR is a novel prognostic marker for differentiated thyroid carcinoma.
20858096 High expression levels of DEPTOR are predictive of response to thalidomide in myeloma.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19446321 DEPTOR is highly overexpressed in a subset of multiple myelomas harboring cyclin D1/D3 or c-MAF/MAFB translocations.

AA Sequence

MEEGGSTGSAGSDSSTSGSGGAQQRELERMAEVLVTGEQLRLRLHEEKVIKDRRHHLKTYPNCFVAKELI      1 - 70
DWLIEHKEASDRETAIKLMQKLADRGIIHHVCDEHKEFKDVKLFYRFRKDDGTFPLDNEVKAFMRGQRLY     71 - 140
EKLMSPENTLLQPREEEGVKYERTFMASEFLDWLVQEGEATTRKEAEQLCHRLMEHGIIQHVSNKHPFVD    141 - 210
SNLLYQFRMNFRRRRRLMELLNEKSPSSQETHDSPFCLRKQSHDNRKSTSFMSVSPSKEIKIVSAVRRSS    211 - 280
MSSCGSSGYFSSSPTLSSSPPVLCNPKSVLKRPVTSEELLTPGAPYARKTFTIVGDAVGWGFVVRGSKPC    281 - 350
HIQAVDPSGPAAAAGMKVCQFVVSVNGLNVLHVDYRTVSNLILTGPRTIVMEVMEELEC               351 - 409
//

Text Mined References (45)

PMID Year Title
26717892 2016 Cul1 promotes melanoma cell proliferation by promoting DEPTOR degradation and enhancing cap-dependent translation.
26608079 2016 Regulation of amino acid transporter trafficking by mTORC1 in primary human trophoblast cells is mediated by the ubiquitin ligase Nedd4-2.
25936805 2015 Rapid mitogenic regulation of the mTORC1 inhibitor, DEPTOR, by phosphatidic acid.
25843797 2015 DEPTOR-related mTOR suppression is involved in metformin's anti-cancer action in human liver cancer cells.
25810016 2015 Deptor enhances triple-negative breast cancer metastasis and chemoresistance through coupling to survivin expression.
25605718 2015 The endosomal sorting complex required for transport pathway mediates chemokine receptor CXCR4-promoted lysosomal degradation of the mammalian target of rapamycin antagonist DEPTOR.
25544749 2014 DEPTOR has growth suppression activity against pancreatic cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
25333702 2014 TGF?-induced deptor suppression recruits mTORC1 and not mTORC2 to enhance collagen I (?2) gene expression.
25258312 2014 DEPTOR is a stemness factor that regulates pluripotency of embryonic stem cells.
25119265 2014 Elucidating the role of DEPTOR in Alzheimer's disease.
24969890 2014 DEPTOR expression negatively correlates with mTORC1 activity and tumor progression in colorectal cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23881914 2013 DEPTOR regulates vascular endothelial cell activation and proinflammatory and angiogenic responses.
23613505 2013 Knockdown of DEPTOR inhibits cell proliferation and increases chemosensitivity to melphalan in human multiple myeloma RPMI-8226 cells via inhibiting PI3K/AKT activity.
23583980 2013 Genome-wide association study identifies multiple susceptibility loci for pulmonary fibrosis.
23563706 2013 Baf60c drives glycolytic metabolism in the muscle and improves systemic glucose homeostasis through Deptor-mediated Akt activation.
23541542 2014 The human myometrium differentially expresses mTOR signalling components before and during pregnancy: evidence for regulation by progesterone.
23503641 2013 Knockdown of DEPTOR induces apoptosis, increases chemosensitivity to doxorubicin and suppresses autophagy in RPMI-8226 human multiple myeloma cells in vitro.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22454292 2012 DEPTOR ubiquitination and destruction by SCF(?-TrCP).
22282237 2012 Molecular mechanisms underlying the time-dependent autophagy and apoptosis induced by nutrient depletion in multiple myeloma: a pilot study.
22160218 2012 Functional characterization of glycine N-methyltransferase and its interactive protein DEPDC6/DEPTOR in hepatocellular carcinoma.
22017877 2011 mTOR generates an auto-amplification loop by triggering the ?TrCP- and CK1?-dependent degradation of DEPTOR.
22017876 2011 DEPTOR, an mTOR inhibitor, is a physiological substrate of SCF(?TrCP) E3 ubiquitin ligase and regulates survival and autophagy.
22017875 2011 mTOR drives its own activation via SCF(?TrCP)-dependent degradation of the mTOR inhibitor DEPTOR.
21992080 2012 Placental DEPTOR as a stress sensor during pregnancy.
21643629 Overexpression of DEP domain containing mTOR-interacting protein correlates with poor prognosis in differentiated thyroid carcinoma.
21269460 2011 Initial characterization of the human central proteome.
20858096 2010 High expression levels of the mammalian target of rapamycin inhibitor DEPTOR are predictive of response to thalidomide in myeloma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19446321 2009 DEPTOR is an mTOR inhibitor frequently overexpressed in multiple myeloma cells and required for their survival.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.