Property Summary

NCBI Gene PubMed Count 30
PubMed Score 27.77
PubTator Score 31.21

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (4)

Gene RIF (18)

PMID Text
26517016 DEPDC5 variants increase fibrosis progression in European subjects with chronic HCV infection. Our findings suggest that DEPDC5 down-regulation may contribute to HCV-related fibrosis by increasing MMP2 synthesis through the beta-catenin pathway
26216793 This study found a single DEPDC5 mutation in one of (2.2%) 45 families with genetic temporal lobe epilepsy, a proportion much lower than that reported in other inherited focal epilepsies.
25964426 This revealed four patients to have two or more tumors that were clonally related, all of which lacked MED12 mutations. DEPDC5 was discovered as a novel tumor suppressor gene playing a role in the progression of uterine leiomyomas.
25764692 MICA and DEPDC5 SNPs were found to be strongly associated with HCV-induced HCC.
25623524 Truncating DEPDC5 mutations were found in all four French families with focal cortical dysplasia and focal epilepsy.
25599672 An association was made for DEPDC5 with sporadic focal cortical dysplasia and also hemimegalencephaly.
25551790 Genetic variations in DEPDC5 gene region may influence HCV-associated liver cirrhosis and/or hepatocellular carcinoma. development.
25366275 The effects of 10 DEPDC5 variants identified in individuals with focal epilepsy and two DEPDC5 variants identified in serous ovarian tumors, on TORC1 signaling and GATOR-1 complex formation.
25194487 This chapter focuses on DEPDC5, a newly identified gene in autosomal dominant focal epilepsies [review]
25032264 PAPL, IL10RB and DEPDC5 polymorphisms have an impact on progression of hepatitis B virus-related liver disease.
24814846 DEPDC5 loss-of-function mutations may represent a part of the broader familial focal epilepsy with variable foci phenotype found in 30 European families with a presentation of autosomal dominant nocturnal frontal lobe epilepsy.
24591017 Mutations in DEPDC5 are associated with childhood focal epilepsies.
24585383 DEPDC5 mutations are associated with both lesional and nonlesional epilepsies.
24283814 A recurrent mutation in DEPDC5 predisposes to focal epilepsies in the French-Canadian population.
23542701 Mutations in DEPDC5 cause familial focal epilepsy with variable foci.
23542697 Mutations in DEPDC5 cause familial focal epilepsy with variable foci.
21725309 Variation in the DEPDC5 locus is associated with progression to hepatocellular carcinoma in chronic hepatitis C virus carriers.
18187620 Knockdown of DEP domain containing 5 (DEPDC5) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MRTTKVYKLVIHKKGFGGSDDELVVNPKVFPHIKLGDIVEIAHPNDEYSPLLLQVKSLKEDLQKETISVD      1 - 70
QTVTQVFRLRPYQDVYVNVVDPKDVTLDLVELTFKDQYIGRGDMWRLKKSLVSTCAYITQKVEFAGIRAQ     71 - 140
AGELWVKNEKVMCGYISEDTRVVFRSTSAMVYIFIQMSCEMWDFDIYGDLYFEKAVNGFLADLFTKWKEK    141 - 210
NCSHEVTVVLFSRTFYDAKSVDEFPEINRASIRQDHKGRFYEDFYKVVVQNERREEWTSLLVTIKKLFIQ    211 - 280
YPVLVRLEQAEGFPQGDNSTSAQGNYLEAINLSFNVFDKHYINRNFDRTGQMSVVITPGVGVFEVDRLLM    281 - 350
ILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRSAPRDSRLGDDYNIPHWINHSFYTSKSQLFCNSFT    351 - 420
PRIKLAGKKPASEKAKNGRDTSLGSPKESENALPIQVDYDAYDAQVFRLPGPSRAQCLTTCRSVRERESH    421 - 490
SRKSASSCDVSSSPSLPSRTLPTEEVRSQASDDSSLGKSANILMIPHPHLHQYEVSSSLGYTSTRDVLEN    491 - 560
MMEPPQRDSSAPGRFHVGSAESMLHVRPGGYTPQRALINPFAPSRMPMKLTSNRRRWMHTFPVGPSGEAI    561 - 630
QIHHQTRQNMAELQGSGQRDPTHSSAELLELAYHEAAGRHSNSRQPGDGMSFLNFSGTEELSVGLLSNSG    631 - 700
AGMNPRTQNKDSLEDSVSTSPDPILTLSAPPVVPGFCCTVGVDWKSLTTPACLPLTTDYFPDRQGLQNDY    701 - 770
TEGCYDLLPEADIDRRDEDGVQMTAQQVFEEFICQRLMQGYQIIVQPKTQKPNPAVPPPLSSSPLYSRGL    771 - 840
VSRNRPEEEDQYWLSMGRTFHKVTLKDKMITVTRYLPKYPYESAQIHYTYSLCPSHSDSEFVSCWVEFSH    841 - 910
ERLEEYKWNYLDQYICSAGSEDFSLIESLKFWRTRFLLLPACVTATKRITEGEAHCDIYGDRPRADEDEW    911 - 980
QLLDGFVRFVEGLNRIRRRHRSDRMMRKGTAMKGLQMTGPISTHSLESTAPPVGKKGTSALSALLEMEAS    981 - 1050
QKCLGEQQAAVHGGKSSAQSAESSSVAMTPTYMDSPRKDGAFFMEFVRSPRTASSAFYPQVSVDQTATPM   1051 - 1120
LDGTSLGICTGQSMDRGNSQTFGNSQNIGEQGYSSTNSSDSSSQQLVASSLTSSSTLTEILEAMKHPSTG   1121 - 1190
VQLLSEQKGLSPYCFISAEVVHWLVNHVEGIQTQAMAIDIMQKMLEEQLITHASGEAWRTFIYGFYFYKI   1191 - 1260
VTDKEPDRVAMQQPATTWHTAGVDDFASFQRKWFEVAFVAEELVHSEIPAFLLPWLPSRPASYASRHSSF   1261 - 1330
SRSFGGRSQAAALLAATVPEQRTVTLDVDVNNRTDRLEWCSCYYHGNFSLNAAFEIKLHWMAVTAAVLFE   1331 - 1400
MVQGWHRKATSCGFLLVPVLEGPFALPSYLYGDPLRAQLFIPLNISCLLKEGSEHLFDSFEPETYWDRMH   1401 - 1470
LFQEAIAHRFGFVQDKYSASAFNFPAENKPQYIHVTGTVFLQLPYSKRKFSGQQRRRRNSTSSTNQNMFC   1471 - 1540
EERVGYNWAYNTMLTKTWRSSATGDEKFADRLLKDFTDFCINRDNRLVTFWTSCLEKMHASAP          1541 - 1603
//

Text Mined References (33)

PMID Year Title
26517016 2016 DEPDC5 variants increase fibrosis progression in Europeans with chronic hepatitis C virus infection.
26216793 2015 DEPDC5 mutations are not a frequent cause of familial temporal lobe epilepsy.
25964426 2015 Clonally related uterine leiomyomas are common and display branched tumor evolution.
25764692 2015 [Hepatitis C virus induced hepatocellular carcinoma associated genes].
25623524 2015 Familial focal epilepsy with focal cortical dysplasia due to DEPDC5 mutations.
25599672 2015 Mammalian target of rapamycin pathway mutations cause hemimegalencephaly and focal cortical dysplasia.
25551790 2014 Variations in DEPDC5 gene and its association with chronic hepatitis C virus infection in Saudi Arabia.
25457612 2014 Sestrins inhibit mTORC1 kinase activation through the GATOR complex.
25366275 2015 Preliminary functional assessment and classification of DEPDC5 variants associated with focal epilepsy.
25194487 2014 Genetics advances in autosomal dominant focal epilepsies: focus on DEPDC5.
25032264 2014 Role of IFN-ks, IFN-ks related genes and the DEPDC5 gene in Hepatitis B virus-related liver disease.
24939585 2015 Genome-wide association analysis demonstrates the highly polygenic character of age-related hearing impairment.
24814846 2014 DEPDC5 mutations in families presenting as autosomal dominant nocturnal frontal lobe epilepsy.
24591017 2014 DEPDC5 mutations in genetic focal epilepsies of childhood.
24585383 2014 Mutations in mammalian target of rapamycin regulator DEPDC5 cause focal epilepsy with brain malformations.
24283814 2014 A recurrent mutation in DEPDC5 predisposes to focal epilepsies in the French-Canadian population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23723238 2013 A Tumor suppressor complex with GAP activity for the Rag GTPases that signal amino acid sufficiency to mTORC1.
23542701 2013 Mutations of DEPDC5 cause autosomal dominant focal epilepsies.
23542697 2013 Mutations in DEPDC5 cause familial focal epilepsy with variable foci.
22449649 2012 Genome-wide association study of intelligence: additive effects of novel brain expressed genes.
21725309 2011 Variation in the DEPDC5 locus is associated with progression to hepatocellular carcinoma in chronic hepatitis C virus carriers.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17897319 2007 Integral and associated lysosomal membrane proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15770670 2005 Complex chromosome 22 rearrangements in astrocytic tumors identified using microsatellite and chromosome 22 tile path array analysis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.