Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung carcinoma 2843 1.1e-18
ovarian cancer 8520 4.0e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Myopia 176 3.405 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 1.300 1.1e-18
ovarian cancer -1.200 4.0e-04

AA Sequence

MVPGEEPARELMAVLLTPRFRRLVSQNELPGPGLNGPSSRNRRDGFCRKRRTGCSGPFQATQLWDGIIHS      1 - 70
LQAQVEIKRRRHHLQTYKDCFTGSDAVDVVLSHLMQNTCLSSNDISCLKGVHLCQVLMNHKVFEPVGMKK     71 - 140
LFKKEKELEFEDSNISLYRFLGNKSSYDCCKRQKDAENEFNETLRPGYEMISNPLAQEIGEERIEELIHT    141 - 210
INGNPALCPNITVQKPFLRLSKEDVWKEQTLLCLLQLIHLPFLDNILEPPVKTQNLQLNKEEDLVITNTC    211 - 280
LDRELIPSLCLPEK                                                            281 - 294
//

Text Mined References (5)

PMID Year Title