Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.71
PubTator Score 3.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
osteosarcoma -2.593 7.3e-04
glioblastoma 1.700 7.0e-05
group 3 medulloblastoma 3.000 2.7e-06
atypical teratoid/rhabdoid tumor 1.900 2.2e-06
medulloblastoma, large-cell 2.600 3.0e-04
primitive neuroectodermal tumor 2.400 3.2e-05
Atopic dermatitis 1.800 2.0e-04
adrenocortical carcinoma 1.486 5.9e-03
non-small cell lung cancer 1.780 3.7e-17
intraductal papillary-mucinous carcinoma... 1.900 1.8e-02
intraductal papillary-mucinous neoplasm ... 2.800 3.5e-05
pancreatic cancer 1.300 4.2e-04
pediatric high grade glioma 1.500 7.4e-04
psoriasis 2.200 1.7e-158
nasopharyngeal carcinoma 1.800 6.2e-05
Breast cancer 1.900 8.1e-10
invasive ductal carcinoma 1.200 4.6e-03
ovarian cancer 1.800 3.4e-03

Synonym

Accession Q8WUY9 A8K3R9 B4DUT4 Q86WJ3 Q8IZY6 Q9NUN3 Q9NW57
Symbols XTP1
BRCC3

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

PMID Text
25704760 Pitx2-mediated repression of Depdc1b expression contributes to the regulation of multiple molecular pathways, such as Rho GTPase signaling.
25091805 proliferation was linked to a novel DEPDC1B-Rac1-ERK1/2 signaling axis in oral cancer cell lines.
24971537 Taken together, our data demonstrate that DEPDC1B might confer metastasis-related malignant phenotype to NSCLC in a Wnt/beta-catenin dependent manner, providing new insights in developing novel anti-NSCLC strategies.
20923822 Observational study and genome-wide association study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEHRIVGPGPYRATRLWNETVELFRAKMPLRKHRCRFKSYEHCFTAAEAVDWLHELLRCSQNFGPEVTRK      1 - 70
QTVQLLKKFLKNHVIEDIKGKWGEEDFEDNRHLYRFPPSSPLKPYPKKPPNQKDVIKFPEWNDLPPGTSQ     71 - 140
ENIPVRPVVMNSEMWYKRHSIAIGEVPACRLVHRRQLTEANVEEIWKSMTLSYLQKILGLDSLEEVLDVK    141 - 210
LVNSKFIIHNVYSVSKQGVVILDDKSKELPHWVLSAMKCLANWPNCSDLKQPMYLGFEKDVFKTIADYYG    211 - 280
HLKEPLLTFHLFDAFVSVLGLLQKEKVAVEAFQICCLLLPPENRRKLQLLMRMMARICLNKEMPPLCDGF    281 - 350
GTRTLMVQTFSRCILCSKDEVDLDELLAARLVTFLMDNYQEILKVPLALQTSIEERVAHLRRVQIKYPGA    351 - 420
DMDITLSAPSFCRQISPEEFEYQRSYGSQEPLAALLEEVITDAKLSNKEKKKKLKQFQKSYPEVYQERFP    421 - 490
TPESAALLFPEKPKPKPQLLMWALKKPFQPFQRTRSFRM                                   491 - 529
//

Text Mined References (11)

PMID Year Title
25704760 2015 Identification of the GTPase-activating protein DEP domain containing 1B (DEPDC1B) as a transcriptional target of Pitx2.
25458010 2014 DEPDC1B coordinates de-adhesion events and cell-cycle progression at mitosis.
25091805 2014 A putative novel protein, DEPDC1B, is overexpressed in oral cancer patients, and enhanced anchorage-independent growth in oral cancer cells that is mediated by Rac1 and ERK.
24971537 2014 DEPDC1B enhances migration and invasion of non-small cell lung cancer cells via activating Wnt/?-catenin signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20923822 2010 Radiation pharmacogenomics: a genome-wide association approach to identify radiation response biomarkers using human lymphoblastoid cell lines.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.