Property Summary

NCBI Gene PubMed Count 15
PubMed Score 19.30
PubTator Score 9.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adrenocortical carcinoma 1.175 3.8e-02
adult high grade glioma 2.000 4.8e-04
Atopic dermatitis 1.600 2.5e-04
atypical teratoid / rhabdoid tumor 2.700 1.6e-10
Breast cancer 2.400 3.4e-02
breast carcinoma 1.300 1.3e-31
ductal carcinoma in situ 1.900 8.6e-03
ependymoma 1.300 4.9e-06
glioblastoma 1.500 2.0e-03
group 3 medulloblastoma 2.900 9.2e-07
intraductal papillary-mucinous carcinoma... 1.200 4.7e-03
intraductal papillary-mucinous neoplasm ... 1.200 5.4e-03
invasive ductal carcinoma 2.400 1.0e-04
lung adenocarcinoma 1.200 1.5e-06
lung cancer 1.100 5.3e-03
malignant mesothelioma 1.100 4.7e-05
medulloblastoma, large-cell 3.200 1.8e-06
nasopharyngeal carcinoma 1.100 4.0e-03
non-small cell lung cancer 1.827 1.1e-21
ovarian cancer 1.300 8.4e-08
primary Sjogren syndrome 1.100 1.3e-03
primitive neuroectodermal tumor 1.900 1.1e-03
psoriasis 1.200 5.1e-07

Gene RIF (10)

AA Sequence

MESQGVPPGPYRATKLWNEVTTSFRAGMPLRKHRQHFKKYGNCFTAGEAVDWLYDLLRNNSNFGPEVTRQ      1 - 70
QTIQLLRKFLKNHVIEDIKGRWGSENVDDNNQLFRFPATSPLKTLPRRYPELRKNNIENFSKDKDSIFKL     71 - 140
RNLSRRTPKRHGLHLSQENGEKIKHEIINEDQENAIDNRELSQEDVEEVWRYVILIYLQTILGVPSLEEV    141 - 210
INPKQVIPQYIMYNMANTSKRGVVILQNKSDDLPHWVLSAMKCLANWPRSNDMNNPTYVGFERDVFRTIA    211 - 280
DYFLDLPEPLLTFEYYELFVNILVVCGYITVSDRSSGIHKIQDDPQSSKFLHLNNLNSFKSTECLLLSLL    281 - 350
HREKNKEESDSTERLQISNPGFQERCAKKMQLVNLRNRRVSANDIMGGSCHNLIGLSNMHDLSSNSKPRC    351 - 420
CSLEGIVDVPGNSSKEASSVFHQSFPNIEGQNNKLFLESKPKQEFLLNLHSEENIQKPFSAGFKRTSTLT    421 - 490
VQDQEELCNGKCKSKQLCRSQSLLLRSSTRRNSYINTPVAEIIMKPNVGQGSTSVQTAMESELGESSATI    491 - 560
NKRLCKSTIELSENSLLPASSMLTGTQSLLQPHLERVAIDALQLCCLLLPPPNRRKLQLLMRMISRMSQN    561 - 630
VDMPKLHDAMGTRSLMIHTFSRCVLCCAEEVDLDELLAGRLVSFLMDHHQEILQVPSYLQTAVEKHLDYL    631 - 700
KKGHIENPGDGLFAPLPTYSYCKQISAQEFDEQKVSTSQAAIAELLENIIKNRSLPLKEKRKKLKQFQKE    701 - 770
YPLIYQKRFPTTESEAALFGDKPTIKQPMLILRKPKFRSLR                                 771 - 811
//

Text Mined References (19)

PMID Year Title