Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma -1.400 2.0e-05
medulloblastoma, large-cell -1.200 1.5e-03
osteosarcoma -1.446 2.8e-06
posterior fossa group B ependymoma 1.200 9.5e-06

AA Sequence

MDALLGTGPRRARGCLGAAGPTSSGRAARTPAAPWARFSAWLECVCVVTFDLELGQALELVYPNDFRLTD      1 - 70
KEKSSICYLSFPDSHSGCLGDTQFSFRMRQCGGQRSPWHADDRHYNSRAPVALQREPAHYFGYVYFRQVK     71 - 140
DSSVKRGYFQKSLVLVSRLPFVRLFQALLSLIAPEYFDKLAPCLEAVCSEIDQWPAPAPGQTLNLPVMGV    141 - 210
VVQVRIPSRVDKSESSPPKQFDQENLLPAPVVLASVHELDLFRCFRPVLTHMQTLWELMLLGEPLLVLAP    211 - 280
SPDVSSEMVLALTSCLQPLRFCCDFRPYFTIHDSEFKEFTTRTQAPPNVVLGVTNPFFIKTLQHWPHILR    281 - 350
VGEPKMSGDLPKQVKLKKPSRLKTLDTKPGLYTAYTAHLHRDKALLKRLLKGVQKKRPSDVQSALLRRHL    351 - 420
LELTQSFIIPLEHYMASLMPLQKSITPWKTPPQIQPFSQDDFLRSLEHAGPQLTCILKGDWLGLYRRFFK    421 - 490
SPHFDGWYRQRHKEMALKLEALHLEAICEANIETWMKDKSEVEVVDLVLKLREKLVRAQGHQLPVKEATL    491 - 560
QRAQLYIETVIGSLPKDLQAVLCPP                                                 561 - 585
//

Text Mined References (8)

PMID Year Title