Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.40
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
urothelial carcinoma -2.100 5.5e-06
osteosarcoma -1.351 9.2e-03
pancreatic ductal adenocarcinoma liver m... -1.129 1.0e-03
diabetes mellitus -1.300 3.9e-03
interstitial cystitis -1.700 6.4e-05
lung adenocarcinoma -1.300 2.2e-16
nasopharyngeal carcinoma -1.500 3.5e-07
lung carcinoma -1.500 1.7e-13
spina bifida -2.362 4.1e-02
Breast cancer -1.700 1.5e-18
mucosa-associated lymphoid tissue lympho... 1.732 4.7e-03
ovarian cancer -1.100 1.0e-07
pituitary cancer 1.300 3.3e-03

AA Sequence

MDVGFSRTTVQTLSRSHCKNIKQKISQWEGRANGISNPEKWCPKDFGVRYNCHQEIRLKKNPIAERKSKN      1 - 70
LDVTSRENVGLDINENTKSHDQSENENKKHEYDDTHFFKNESESNWVCSRVKEIESCKEDVLDPETSLPP     71 - 140
GNFYTSQILWKKIEALPPDKLLNLALEHCDSSEKELNFRVLDSSYGITKSLENIYSEPEGQECGPSINPL    141 - 210
PKPRRTFRYLSESGVTPYKERNCDKKYCENNSCAQSSLASSQEPEPKKYGGKIRGRSKRKSFEFEDIQHF    211 - 280
RNRNSQTIREELGRNSGSALYYTQSEDNIYEDIIYPTKENPYEDIPVQPLPMWRSPSAWKLPPAKSAFKA    281 - 350
PKLPPKPQFLHRKTMEVKNSQAYLRSKLTKDTTLPVTLTEWKLFRAGEVANTKRKNLPRLVLKIDDIFES    351 - 420
KRGKKKVKLHSYTGKELPPTKGETSGNESDAEYLPKNRHKRLAQLQPSSKRNPHYQTLERDLIELQEQQL    421 - 490
FELFVVVSLQKKPSGISYIPQVIQQFPGKDDHGYKQSKDMEERLKVIPKFCFPDSKDWMPTSELKSETFS    491 - 560
FVLTGEDGSRWFGYCKKLLPVGKGKRLPEVYCMVSRLGCFNLFSKILDEVEKRREMSPALVYPFMRSVME    561 - 630
APFPAPGRTITVKSYLPGAGDESIELCRPLDSRLEHVDFKCLFKCLSVCHLIRVCASLLLERRVIFVANS    631 - 700
LSTLSKCGHAVVATLYPFTWQHTYIPVLPASMIDIVCSPTPFLIGILSCSLPQLQDLPIEEVLIVDLCAD    701 - 770
KFLQEVSDEDEILPPKLQAALMQILEERNEILTQEQNFSQDVTLNSLVSEAFVRFFVELVGHYSLNMTVT    771 - 840
ERGERVFQREPFRKSHTSRSVRHFLDLFMETQMFAGFIQDRELRKSGVKGLFEIRAIQYLETIPESEPSG    841 - 910
MNRILRSLGSKMKFLQKK                                                        911 - 928
//

Text Mined References (9)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24189344 2014 Common genetic variants on 1p13.2 associate with risk of autism.
20937701 2010 Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.