Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
breast carcinoma -1.600 3.4e-07
colon cancer -1.400 2.6e-04
ductal carcinoma in situ -1.500 1.7e-04
glioblastoma 1.100 5.8e-04
group 3 medulloblastoma 1.400 3.5e-03
invasive ductal carcinoma -1.045 1.0e-02
lung adenocarcinoma -1.300 1.2e-07
lung cancer -2.200 1.4e-05
malignant mesothelioma 3.400 1.4e-07
non-small cell lung cancer -1.181 1.4e-21
psoriasis -1.400 3.2e-46
ulcerative colitis -1.200 1.3e-04

Gene RIF (1)

AA Sequence

MDMFSLDMIISDPAAEASRAGKKQLRGVQNPCPSARARPRHKSLNIKDKISEWEGKKEVPTPAPSRRADG      1 - 70
QEDYLPSSTVERRSSDGVRTQVTEAKNGMRPGTESTEKERNKGAVNVGGQDPEPGQDLSQPEREVDPSWG     71 - 140
RGREPRLGKLRFQNDPLSVLKQVKKLEQALKDGSAGLDPQLPGTCYSPHCPPDKAEAGSTLPENLGGGSG    141 - 210
SEVSQRVHPSDLEGREPTPELVEDRKGSCRRPWDRSLENVYRGSEGSPTKPFINPLPKPRRTFKHAGEGD    211 - 280
KDGKPGIGFRKEKRNLPPLPSLPPPPLPSSPPPSSVNRRLWTGRQKSSADHRKSYEFEDLLQSSSESSRV    281 - 350
DWYAQTKLGLTRTLSEENVYEDILDPPMKENPYEDIELHGRCLGKKCVLNFPASPTSSIPDTLTKQSLSK    351 - 420
PAFFRQNSERRNFKLLDTRKLSRDGTGSPSKISPPSTPSSPDDIFFNLGDPQNGRKKRKIPKLVLRINAI    421 - 490
YEVRRGKKRVKRLSQSMESNSGKVTDENSESDSDTEEKLKAHSQRLVNVKSRLKQAPRYPSLARELIEYQ    491 - 560
ERQLFEYFVVVSLHKKQAGAAYVPELTQQFPLKLERSFKFMREAEDQLKAIPQFCFPDAKDWVPVQQFTS    561 - 630
ETFSFVLTGEDGSRRFGYCRRLLPGGKGKRLPEVYCIVSRLGCFSLFSRILDEVEKRRGISPALVQPLMR    631 - 700
SVMEAPFPALGKTILVKNFLPGSGTEVIELCRPLDSRLEHVDFESLFSSLSVRHLVCVFASLLLERRVIF    701 - 770
IADKLSILSKCCHAMVALIYPFAWQHTYIPVLPPAMVDIVCSPTPFLIGLLSSSLPLLRELPLEEVLVVD    771 - 840
LVNSRFLRQMDDEDSILPRKLQVALEHILEQRNELACEQDEGPLDGRHGPESSPLNEVVSEAFVRFFVEI    841 - 910
VGHYSLFLTSGEREERTLQREAFRKAVSSKSLRHFLEVFMETQMFRGFIQERELRRQDAKGLFEVRAQEY    911 - 980
LETLPSGEHSGVNKFLKGLGNKMKFLHKK                                             981 - 1009
//

Text Mined References (8)

PMID Year Title