Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.36
PubTator Score 1.53

Knowledge Summary


No data available


  Disease (1)


  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.200 2.3e-05
cutaneous lupus erythematosus 1.900 4.7e-03
osteosarcoma -3.260 4.4e-08
interstitial cystitis 1.700 7.9e-04
ovarian cancer 1.300 1.6e-09

Gene RIF (1)

22072793 whereas connecdenn 1 and 2 activate Rab35 for endosomal trafficking, connecdenn 3 uniquely activates Rab35 for its role in actin regulation

AA Sequence

LNSPATPTSNCQKSQPSSRPRVADLKKCFEG                                           771 - 801

Text Mined References (10)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
22072793 2012 Connecdenn 3/DENND1C binds actin linking Rab35 activation to the actin cytoskeleton.
20937701 2010 Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.
20154091 2010 The connecdenn family, Rab35 guanine nucleotide exchange factors interfacing with the clathrin machinery.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.