Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.46
PubTator Score 8.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
Rheumatoid Arthritis 2.500 1.5e-05
hepatocellular carcinoma -1.100 2.4e-02
Multiple myeloma 1.429 4.6e-02
osteosarcoma 2.483 1.8e-05
cystic fibrosis 1.437 5.6e-05
medulloblastoma, large-cell 1.200 2.3e-02
primitive neuroectodermal tumor 1.300 2.8e-03
tuberculosis -1.100 1.4e-04
intraductal papillary-mucinous adenoma (... 2.700 9.7e-04
intraductal papillary-mucinous carcinoma... 2.800 1.6e-03
intraductal papillary-mucinous neoplasm ... 2.000 2.5e-02
lung cancer -1.600 7.9e-03
sarcoidosis 1.400 1.2e-02
Breast cancer 2.300 4.1e-02
adult high grade glioma 1.500 2.6e-04
group 3 medulloblastoma 2.300 3.2e-06
non primary Sjogren syndrome sicca -1.400 1.8e-02
invasive ductal carcinoma 2.200 1.7e-03
psoriasis 1.100 5.6e-10
breast carcinoma 1.300 2.2e-20
Pick disease 1.100 5.7e-04
ductal carcinoma in situ 1.800 6.6e-05
ovarian cancer -1.600 1.2e-05

Protein-protein Interaction (1)

Gene RIF (7)

PMID Text
26774822 Study reveals a previously unrecognized mechanism by which DENND1B regulates surface TCR dynamics to fine-tune TH2 cell signaling and effector functions. Dennd1b-/- TH2 cells exhibit delayed TCR downmodulation following TCR activation that is associated with enhanced TCR signaling and greater transcriptional activation and secretion of TH2-associated cytokines.
26055712 The guanine nucleotide exchange factor activity of connecdenn 1 and 2 are autoinhibited, and this is regulated by Akt activation downstream of insulin stimulation.
24347560 Increased fraction of exhaled nitric oxide in healthy newborns seems strongly influenced by genetics including father's atopy and child's variants in the DENND1B locus at chromosome 1q31.3.
22977732 Data indicate that folliculin-CT is structurally similar to the DENN domain of DENND1B.
22065758 analysis of DENND1B-S complexed with its substrate Rab35
20816195 Observational study of gene-disease association. (HuGE Navigator)
20032318 We have identified a locus containing DENND1B on chromosome 1q31.3 that is associated with susceptibility to asthma.

AA Sequence

MDCRTKANPDRTFDLVLKVKCHASENEDPVVLWKFPEDFGDQEILQSVPKFCFPFDVERVSQNQVGQHFT      1 - 70
FVLTDIESKQRFGFCRLTSGGTICLCILSYLPWFEVYYKLLNTLADYLAKELENDLNETLRSLYNHPVPK     71 - 140
ANTPVNLSVNQEIFIACEQVLKDQPALVPHSYFIAPDVTGLPTIPESRNLTEYFVAVDVNNMLQLYASML    141 - 210
HERRIVIISSKLSTLTACIHGSAALLYPMYWQHIYIPVLPPHLLDYCCAPMPYLIGIHSSLIERVKNKSL    211 - 280
EDVVMLNVDTNTLESPFSDLNNLPSDVVSALKNKLKKQSTATGDGVARAFLRAQAALFGSYRDALRYKPG    281 - 350
EPITFCEESFVKHRSSVMKQFLETAINLQLFKQFIDGRLAKLNAGRGFSDVFEEEITSGGFCGGNPRSYQ    351 - 420
QWVHTVKKGGALFNTAMTKATPAVRTAYKFAKNHAKLGLKEVKSKLKHKENEEDYGTCSSSVQYTPVYKL    421 - 490
HNEKGGNSEKRKLAQARLKRPLKSLDGALYDDEDDDDIERASKLSSEDGEEASAYLYESDDSVETRVKTP    491 - 560
YSGEMDLLGEILDTLSTHSSDQGKLAAAKSLDFFRSMDDIDYKPTNKSNAPSENNLAFLCGGSGDQAEWN    561 - 630
LGQDDSALHGKHLPPSPRKRVSSSGLTDSLFILKEENSNKHLGADNVSDPTSGLDFQLTSPEVSQTDKGK    631 - 700
TEKRETLSQISDDLLIPGLGRHSSTFVPWEKEGKEAKETSEDIGLLHEVVSLCHMTSDFQQSLNISDKNT    701 - 770
NGNQT                                                                     771 - 775
//

Text Mined References (25)

PMID Year Title
26774822 2016 Regulation of T Cell Receptor Signaling by DENND1B in TH2 Cells and Allergic Disease.
26055712 2015 Phosphorylation-dependent Regulation of Connecdenn/DENND1 Guanine Nucleotide Exchange Factors.
24520163 2014 Diversity and plasticity in Rab GTPase nucleotide release mechanism has consequences for Rab activation and inactivation.
24347560 2015 DENND1B gene variants associate with elevated exhaled nitric oxide in healthy high-risk neonates.
23999434 2013 Common genetic variation at the IL1RL1 locus regulates IL-33/ST2 signaling.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22977732 2012 Crystal structure of folliculin reveals a hidDENN function in genetically inherited renal cancer.
22065758 2011 Insights regarding guanine nucleotide exchange from the structure of a DENN-domain protein complexed with its Rab GTPase substrate.
21399635 2011 Genome-wide association study identifies 12 new susceptibility loci for primary biliary cirrhosis.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20937701 2010 Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.
20816195 2010 Analyses of shared genetic factors between asthma and obesity in children.
20154091 2010 The connecdenn family, Rab35 guanine nucleotide exchange factors interfacing with the clathrin machinery.
20032318 2010 Variants of DENND1B associated with asthma in children.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.