Welcome to Pharos

Since this is your first visit to the site, you are seeing this message. It will not be displayed on subsequent visits.

Pharos Logo
  • Diseases
  • Targets
  • Ligands
  • RFA
  • API
  • Help
    • General information
    • Frequently asked questions
    • Download TCRD
    • Video tutorials
    • About
  • Explore
  • Target Filters...
  • Sequence Search
  • Batch Search

Sequence Search


Batch Search

  1. Home
  2. Targets
  3. Beta-defensin 133

Tdark Beta-defensin 133
  • Add to cart
  • View Collections
  • Empty Collection

Has antibacterial activity.

 Comments

Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  • Specificity
  • Differential
  • GTEx
  • HPM
  • HPA
  • IDG
  • UniProt
  • Jensen-KB
  • Jensen-TM
Liver 18,071
epididymis 15,863
Male tissues 17,142
See source...
See source...

Synonym

Accession Q30KQ1 Q4QY39
Symbols

Gene

DEFB133

  Ortholog (2)

Species Source Disease
Chimp 14,140
Inparanoid OMA
Rat 15,117
Inparanoid OMA

 UniProt Keyword (8)

Complete proteome 20,231
Reference proteome 20,231
Disulfide bond 3,599
Secreted 2,041
Signal 3,561
Antibiotic 78
Antimicrobial 91
Defensin 40

 GO Component (2)

cell surface 608
extracellular region 1,833

 GO Process (2)

innate immune response 469
defense response to bacterium 159

 Compartment GO Term (5)

Cell 16,178
Cell part 16,177
Cell surface 842
Extracellular region 2,732
cellular_component 18,320

 HCA RNA Cell Line (2)

K-562 16,233
U-2 OS 17,559

Pathway (5)

Immune System 2,101
Innate Immune System 1,176
Antimicrobial peptides 82
Defensins 38
Beta defensins 30

AA Sequence

MKIHVFLFVLFFFLVPIATRVKCAVKDTYSCFIMRGKCRHECHDFEKPIGFCTKLNANCYM               1 - 61
//

Text Mined References (1)

  • Summary
  • Details
PMID Year Title

Select a dossier

Knowledge Availability

Download

  • NCATS Home
  • Privacy Notice
  • Comment Policy
  • Disclaimer
  • Accessibility
  • FOIA
  • OIG

Build: Sat Nov 17 23:53:08 EST 2018 (commit: a759bb7)

National Center for Advancing Translational Sciences (NCATS), 6701 Democracy Boulevard, Bethesda MD 20892-4874 • 301-435-0888