Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.50

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MKLHSLISVLLLFVTLIPKGKTGVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYP      1 - 70
TPVPKGKSP                                                                  71 - 79
//

Text Mined References (4)

PMID Year Title